ESM1

ESM1
Identifikatori
AliasiESM1
Vanjski ID-jeviOMIM: 601521 MGI: 1918940 HomoloGene: 5107 GeneCards: ESM1
Lokacija gena (čovjek)
Hromosom 5 (čovjek)
Hrom.Hromosom 5 (čovjek)[1]
Hromosom 5 (čovjek)
Genomska lokacija za ESM1
Genomska lokacija za ESM1
Bend5q11.2Početak54,977,867 bp[1]
Kraj55,022,671 bp[1]
Lokacija gena (miš)
Hromosom 13 (miš)
Hrom.Hromosom 13 (miš)[2]
Hromosom 13 (miš)
Genomska lokacija za ESM1
Genomska lokacija za ESM1
Bend13|13 D2.2Početak113,346,193 bp[2]
Kraj113,354,632 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija integrin binding
insulin-like growth factor binding
hepatocyte growth factor receptor binding
Ćelijska komponenta extracellular region
Biološki proces sprouting angiogenesis
regulation of cell growth
Angiogeneza
positive regulation of cell population proliferation
positive regulation of hepatocyte growth factor receptor signaling pathway
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_007036
NM_001135604

NM_023612

RefSeq (bjelančevina)

NP_001129076
NP_008967

NP_076101

Lokacija (UCSC)Chr 5: 54.98 – 55.02 MbChr 13: 113.35 – 113.35 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Endotelna ćelijski specifična molekula 1 jest protein koji je kod ljudi kodiran genom ESM1.[5][6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 184 aminokiseline, а molekulska težina 20.095 Da.[7].

1020304050
MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDD
CGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICK
DCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLT
EHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR

Funkcija

Ovaj gen kodira izlučeni protein koji se uglavnom eksprimira u endotelnim ćelijama u ljudskim plućnim i bubrežnim tkivima. Ekspresiju ovog gena reguliraju citokini, što sugerira da on može imati ulogu u patološkim poremećajima ovisnim o endotelu. Transkript sadrži više signala nestabilnosti poliadenilacije i iRNK.[6]

Genski proizvod ESM-1 također se naziva endokan, od 2001. godine, kada su ga Bechard et al. okarakterizirali kao dermatan-sulfat proteoglikan. Nedavno su nezavisni timovi opisali endokan/ESM-1 kao specifični biomarker vršnih ćelija tokom neoangiogeneze. Pokazalo se da je ekspresija endokana povećana u prisutnosti proangiogenih faktora rasta, kao što je faktor rasta vaskularnog endotela (VEGF) ili faktor rasta fibroblasta 2 (FGF-2). Kod hipervaskulariziranih karcinoma, imunohistohemijski otkrivena je prekomjerna ekspresija endokana, upotrebom monoklonskih antitijela protiv endokana/ESM-1.

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000164283 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000042379 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Lassalle P, Molet S, Janin A, Heyden JV, Tavernier J, Fiers W, Devos R, Tonnel AB (Oct 1996). "ESM-1 is a novel human endothelial cell-specific molecule expressed in lung and regulated by cytokines". J Biol Chem. 271 (34): 20458–64. doi:10.1074/jbc.271.34.20458. PMID 8702785.
  6. ^ a b "Entrez Gene: ESM1 endothelial cell-specific molecule 1".
  7. ^ "UniProt, Q9NQ30" (jezik: engleski). Pristupljeno 14. 10. 2021.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.