ERG28

ERG28
Identifikatori
AliasiERG28
Vanjski ID-jeviOMIM: 604576 MGI: 1915571 HomoloGene: 38284 GeneCards: ERG28
Lokacija gena (čovjek)
Hromosom 14 (čovjek)
Hrom.Hromosom 14 (čovjek)[1]
Hromosom 14 (čovjek)
Genomska lokacija za ERG28
Genomska lokacija za ERG28
Bend14q24.3Početak75,649,791 bp[1]
Kraj75,660,876 bp[1]
Lokacija gena (miš)
Hromosom 12 (miš)
Hrom.Hromosom 12 (miš)[2]
Hromosom 12 (miš)
Genomska lokacija za ERG28
Genomska lokacija za ERG28
Bend12|12 D2Početak85,862,222 bp[2]
Kraj85,871,324 bp[2]
Obrazac RNK ekspresije




Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija protein-macromolecule adaptor activity
molekularna funkcija
Ćelijska komponenta integral component of membrane
transport vesicle
Endoplazmatski retikulum
membrana
endoplasmic reticulum membrane
Biološki proces steroid metabolic process
sterol biosynthetic process
lipid metabolism
steroid biosynthetic process
ergosterol biosynthetic process
GO:0022610 biološki proces
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_007176

NM_021446
NM_001360451
NM_001360813

RefSeq (bjelančevina)

NP_009107

NP_067421
NP_001347380
NP_001347742

Lokacija (UCSC)Chr 14: 75.65 – 75.66 MbChr 12: 85.86 – 85.87 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Ergosterolski biosintetski protein 28 je protein koji je kod ljudi kodiran genom ERG28.[5][6][7][8]

Radijacijskom analizom hibrida, Veitia et al. (1999) locirali su gen C14ORF1 na hromosomu 14, sekvenca q24, regiji koja je uključena u karcinome bubrežnih i debelocrijevnih ćelija kao i neuroblastoma.[9]

Kloniranje i ekspresija

Pretragom EST baze podataka i skriningom biblioteke cDNK ljudskih sjemenika, Veitia et al. (1999) dobili su novu cDNK pune dužine, koju su označili kao C14ORF1, sa više potencijalnih startnih tačaka transkripcije. CDNK C14ORF1 kodira osnovni transmembranski protein od približno 157 aminokiselina koji ima 98% identiteta sekvence sa homolognim mišjim proteinom.

Northern blot analiza otkrila je ekspresiju transkripta C14ORF1 od 1,35 kb u svim testiranim tkivima i ćelijskim linijama karcinoma, s najjačom ekspresijom u testisima i nekim ćelijskim linijama. Autori su primijetili da je ekspresija C14ORF1 gotovo neotkrivena u normalnoj sluznici debelog crijeva i leukocitima periferne krvi, ali je bila izrazito ispoljena u kolorektumskom adenokarcinomu i nekoliko ćelijskih linija izvedenih iz leukocita.

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 140 aminokiselina, a molekulska težina 15.864 Da [10].

1020304050
MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQA
RTFGIWTLLSSVIRCLCAIDIHNKTLYHITLWTFLLALGHFLSELFVYGT
AAPTIGVLAPLMVASFSILGMLVGLRYLEVEPVSRQKKRN
Simboli

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000133935 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000021252 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Veitia RA, Ottolenghi C, Bissery MC, Fellous A (Oct 1999). "A novel human gene, encoding a potential membrane protein conserved from yeast to man, is strongly expressed in testis and cancer cell lines". Cytogenetics and Cell Genetics. 85 (3–4): 217–20. doi:10.1159/000015296. PMID 10449901.
  6. ^ Schirmer EC, Florens L, Guan T, Yates JR, Gerace L (Sep 2003). "Nuclear membrane proteins with potential disease links found by subtractive proteomics". Science. 301 (5638): 1380–2. doi:10.1126/science.1088176. PMID 12958361.
  7. ^ Gachotte D, Eckstein J, Barbuch R, Hughes T, Roberts C, Bard M (Jan 2001). "A novel gene conserved from yeast to humans is involved in sterol biosynthesis". Journal of Lipid Research. 42 (1): 150–4. PMID 11160377.
  8. ^ "Entrez Gene: C14orf1 chromosome 14 open reading frame 1".
  9. ^ Veitia, R. A., Ottolenghi, C., Bissery, M.-C., Fellous, A. A novel human gene, encoding a potential membrane protein conserved from yeast to man, is strongly expressed in testis and cancer cell lines. Cytogenet. Cell Genet. 85: 217-220, 1999. PubMed: 10449901
  10. ^ "UniProt, Q9UKR5". Pristupljeno 24. 7. 2021.

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.