EMP2

EMP2
Identifikatori
AliasiEMP2
Vanjski ID-jeviOMIM: 602334 MGI: 1098726 HomoloGene: 1089 GeneCards: EMP2
Lokacija gena (čovjek)
Hromosom 16 (čovjek)
Hrom.Hromosom 16 (čovjek)[1]
Hromosom 16 (čovjek)
Genomska lokacija za EMP2
Genomska lokacija za EMP2
Bend16p13.13Početak10,528,422 bp[1]
Kraj10,580,632 bp[1]
Lokacija gena (miš)
Hromosom 16 (miš)
Hrom.Hromosom 16 (miš)[2]
Hromosom 16 (miš)
Genomska lokacija za EMP2
Genomska lokacija za EMP2
Bend16 A1|16 5.54 cMPočetak10,099,613 bp[2]
Kraj10,131,832 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija protein kinase binding
kinase binding
GO:0001948, GO:0016582 vezivanje za proteine
integrin binding
Ćelijska komponenta Kaveole
citoplazma
Golđijev aparat
Golđijeva membrana
jedro
apical part of cell
apical plasma membrane
membrana
cell surface
Lipidni splav
ćelijska membrana
GO:0016023 citoplazmatska vezikula
integral component of membrane
citosol
Biološki proces regulation of kinase activity
Ćelijska smrt
T cell mediated cytotoxicity
regulation of glomerular filtration
regulation of angiogenesis
positive regulation of cell-matrix adhesion
cell-matrix adhesion
actin filament organization
bleb assembly
protein localization to plasma membrane
early endosome to late endosome transport
positive regulation of cell population proliferation
regulation of cell-matrix adhesion
membrane raft assembly
caveola assembly
Ćelijska migracija
regulation of endothelial cell migration
activation of protein kinase activity
protein localization to cell surface
actin-mediated cell contraction
positive regulation of integrin-mediated signaling pathway
regulation of vasculogenesis
Ćelijska adhezija
blood vessel endothelial cell migration
Ćelijska proliferacija
embryo implantation
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001424

NM_007929

RefSeq (bjelančevina)

NP_001415

NP_031955

Lokacija (UCSC)Chr 16: 10.53 – 10.58 MbChr 16: 10.1 – 10.13 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Epitelni membranski protein 2 je protein koji je kod ljudi kodiran genom EMP2.[5][6][7][8] Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 167 aminokiselina, a molekulska težina 19.199 Da.[9]

Simboli
1020304050
MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTV
INDSFQEYSTLQAVQATMILSTILCCIAFFIFVLQLFRLKQGERFVLTSI
IQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAF
ACTFISGMMYLILRKRK

Klinički značaj

Mutacije u EMP2 uzrokuju Nefrotski sindrom s početkom u djetinjstvu.[10]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000213853 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000022505 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Ben-Porath I, Benvenisty N (Feb 1997). "Characterization of a tumor-associated gene, a member of a novel family of genes encoding membrane glycoproteins". Gene. 183 (1–2): 69–75. doi:10.1016/S0378-1119(96)00475-1. PMID 8996089.
  6. ^ Liehr T, Kuhlenbaumer G, Wulf P, Taylor V, Suter U, Van Broeckhoven C, Lupski JR, Claussen U, Rautenstrauss B (Jul 1999). "Regional localization of the human epithelial membrane protein genes 1, 2, and 3 (EMP1, EMP2, EMP3) to 12p12.3, 16p13.2, and 19q13.3". Genomics. 58 (1): 106–8. doi:10.1006/geno.1999.5803. PMID 10331954.
  7. ^ Wadehra M, Forbes A, Pushkarna N, Goodglick L, Gordon LK, Williams CJ, Braun J (Nov 2005). "Epithelial membrane protein-2 regulates surface expression of alphavbeta3 integrin in the endometrium". Dev Biol. 287 (2): 336–45. doi:10.1016/j.ydbio.2005.09.003. PMID 16216233.
  8. ^ "Entrez Gene: EMP2 epithelial membrane protein 2".
  9. ^ "UniProt, P54851". Pristupljeno 5. 7. 2021.
  10. ^ Gee, H. Y.; Ashraf, S; Wan, X; Vega-Warner, V; Esteve-Rudd, J; Lovric, S; Fang, H; Hurd, T. W.; Sadowski, C. E.; Allen, S. J.; Otto, E. A.; Korkmaz, E; Washburn, J; Levy, S; Williams, D. S.; Bakkaloglu, S. A.; Zolotnitskaya, A; Ozaltin, F; Zhou, W; Hildebrandt, F (2014). "Mutations in EMP2 Cause Childhood-Onset Nephrotic Syndrome". The American Journal of Human Genetics. 94 (6): 884–90. doi:10.1016/j.ajhg.2014.04.010. PMC 4121470. PMID 24814193.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.