ELL3

ELL3
Identifikatori
AliasiELL3
Vanjski ID-jeviOMIM: 609885 MGI: 2673679 HomoloGene: 11859 GeneCards: ELL3
Lokacija gena (čovjek)
Hromosom 15 (čovjek)
Hrom.Hromosom 15 (čovjek)[1]
Hromosom 15 (čovjek)
Genomska lokacija za ELL3
Genomska lokacija za ELL3
Bend15q15.3Početak43,772,605 bp[1]
Kraj43,777,315 bp[1]
Lokacija gena (miš)
Hromosom 2 (miš)
Hrom.Hromosom 2 (miš)[2]
Hromosom 2 (miš)
Genomska lokacija za ELL3
Genomska lokacija za ELL3
Bend2|2 E5Početak121,269,491 bp[2]
Kraj121,274,759 bp[2]
Ontologija gena
Molekularna funkcija• GO:0001948, GO:0016582 vezivanje za proteine
Ćelijska komponenta• Jedarce
• transcription elongation factor complex
• jedro
• nukleoplazma
Biološki proces• positive regulation of DNA-templated transcription, elongation
• positive regulation of neurogenesis
• positive regulation of neural precursor cell proliferation
• transcription elongation from RNA polymerase II promoter
• regulation of epithelial to mesenchymal transition
• DNA-templated transcription, elongation
• GO:0009373 regulation of transcription, DNA-templated
• negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
• transcription by RNA polymerase II
• Spermatogeneza
• GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
• stem cell differentiation
• transcription, DNA-templated
• negative regulation of signal transduction by p53 class mediator
• snRNA transcription by RNA polymerase II
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez

80237

269344

Ensembl

ENSG00000128886

ENSMUSG00000027246

UniProt

Q9HB65

Q80VR2

RefSeq (mRNK)

NM_025165

NM_145973

RefSeq (bjelančevina)

NP_079441

NP_666085

Lokacija (UCSC)Chr 15: 43.77 – 43.78 MbChr 2: 121.27 – 121.27 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Elongacijski faktor 3 sličan RNK-polimerazi II je protein koji je kod ljudi kodiran genom ELL3.[5]

Međunarodni konzorcij za radijacijsko mapiranje locirao je gen ELL3 na hromosomu 15 (RH44309).

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 397 aminokiselina, a molekulska težina 45.361 Da.[6].

1020304050
MEELQEPLRGQLRLCFTQAARTSLLLLRLNDAALRALQECQRQQVRPVIA
FQGHRGYLRLPGPGWSCLFSFIVSQCCQEGAGGSLDLVCQRFLRSGPNSL
HCLGSLRERLIIWAAMDSIPAPSSVQGHNLTEDARHPESWQNTGGYSEGD
AVSQPQMALEEVSVSDPLASNQGQSLPGSSREHMAQWEVRSQTHVPNREP
VQALPSSASRKRLDKKRSVPVATVELEEKRFRTLPLVPSPLQGLTNQDLQ
EGEDWEQEDEDMDPRLEHSSSVQEDSESPSPEDIPDYLLQYRAIHSAEQQ
HAYEQDFETDYAEYRILHARVGTASQRFIELGAEIKRVRRGTPEYKVLED
KIIQEYKKFRKQYPSYREEKRRCEYLHQKLSHIKGLILEFEEKNRGS
Simboli

C: Cistein
D: Asparaginska kiselina
E: Glutaminska kiselina
F: Fenilalanin
G: Glicin
H: Histidin
I: Izoleucin
K: Lizin
L: Leucin
M: Metionin
N: Asparagin
P: Prolin
Q: Glutamin
R: Arginin
S: Serin
T: Treonin
V: Valin
W: Triptofan
Y: Tirozin

Kloniranje i ekspresija

Pretragom baze podataka EST, Miller et al. (2000) identificirali su sekvence koje pokazuju visoku homologiju sa C-terminalnim sekvencama ELL i ELL2 . Koristeći strategiju zasnovanu na PCR-u, klonirali su ljudsku cDNA pune dužine, koju su označili kao ELL3. Izvedeni približno 400-aminokiselinski protein dijeli oko 50% identiteta sekvence s ELL i ELL2. Northern blot analizom otkriven je transkript od 2 kb eksprimiran isključivo u sjemenicima. Studije imunofluorescencije lokalizirale su ELL3 u jedru.

Funkcija gena

Miller et al. (2000) utvrdili su da ELL3, poput ELL i ELL2, može povećati katalitsku brzinu izduživanja transkripcije RNK-polimerazom II.[7]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000128886 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000027246 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: Elongation factor RNA polymerase II-like 3".
  6. ^ "UniProt, Q9HB65". Pristupljeno 13. 7. 2021.
  7. ^ Miller, T., Williams, K., Johnstone, R. W., Shilatifard, A. Identification, cloning, expression, and biochemical characterization of the testis-specific RNA polymerase II elongation factor ELL3. J. Biol. Chem. 275: 32052-32056, 2000. PubMed: 10882741

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.