DPPA2

DPPA2
Identifikatori
AliasiDPPA2
Vanjski ID-jeviOMIM: 614445 MGI: 2157523 HomoloGene: 79572 GeneCards: DPPA2
Lokacija gena (čovjek)
Hromosom 3 (čovjek)
Hrom.Hromosom 3 (čovjek)[1]
Hromosom 3 (čovjek)
Genomska lokacija za DPPA2
Genomska lokacija za DPPA2
Bend3q13.13Početak109,293,788 bp[1]
Kraj109,316,517 bp[1]
Lokacija gena (miš)
Hromosom 16 (miš)
Hrom.Hromosom 16 (miš)[2]
Hromosom 16 (miš)
Genomska lokacija za DPPA2
Genomska lokacija za DPPA2
Bend16|16 B5Početak48,124,271 bp[2]
Kraj48,140,086 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
chromatin binding
Ćelijska komponenta jedro
Biološki proces transcription, DNA-templated
GO:0009373 regulation of transcription, DNA-templated
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_138815

NM_028615

RefSeq (bjelančevina)

NP_620170

NP_082891

Lokacija (UCSC)Chr 3: 109.29 – 109.32 MbChr 16: 48.12 – 48.14 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Razvojni pluripotencijski-pridruženi protein 2 jest protein koji je kod ljudi kodiran genom DPPA2 sa hromosoma 3.[5][6][7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 298 aminokiselina, а molekulska težina 33.784 Da.[8]

1020304050
MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDV
KLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLPTILPPINKVCRDTL
RDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKR
KAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPK
ALNSCSIPVSVEAFLMQASGVRWCVVHGRLLSADTKGWVRLQFHAGQAWV
PTTHRRMISLFLLPACIFPSPGIEDNMLCPDCAKRNKKMMKRLMTVEK

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000163530 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000072419 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Du J, Lin G, Nie ZY, Lu GX (decembar 2004). "[Molecular cloning and characterization analysis of HPESCRG1, a novel gene expressed specifically in human embryonic stem cell.]". Zhonghua Yi Xue Yi Chuan Xue Za Zhi. 21 (6): 542–7. PMID 15583978.
  6. ^ "Entrez Gene: DPPA2 developmental pluripotency associated 2".
  7. ^ Klein, Rachel Herndon; Tung, Po-Yuan; Somanath, Priyanka; Fehling, Hans Joerg; Knoepfler, Paul S. (august 2018). "Genomic functions of developmental pluripotency associated factor 4 (Dppa4) in pluripotent stem cells and cancer". Stem Cell Research. 31: 83–94. doi:10.1016/j.scr.2018.07.009. ISSN 1876-7753. PMC 6133722. PMID 30031967.
  8. ^ "UniProt, Q7Z7J5" (jezik: engleski). Pristupljeno 7. 11. 2021.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.