CHMP5

CHMP5
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2LXM, 3ULY, 3UM0, 3UM1, 3UM2, 4TXR

Identifikatori
AliasiCHMP5
Vanjski ID-jeviOMIM: 610900 MGI: 1924209 HomoloGene: 5757 GeneCards: CHMP5
Lokacija gena (miš)
Hromosom 4 (miš)
Hrom.Hromosom 4 (miš)[1]
Hromosom 4 (miš)
Genomska lokacija za CHMP5
Genomska lokacija za CHMP5
Bend4|4 A5Početak40,948,407 bp[1]
Kraj40,965,303 bp[1]
Obrazac RNK ekspresije


Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
cadherin binding
Ćelijska komponenta citoplazma
citosol
endozom
membrana
endosome membrane
Egzosom
jedro
Biološki proces regulation of centrosome duplication
GO:0019067 viral life cycle
nucleus organization
multivesicular body sorting pathway
endosome to lysosome transport
multivesicular body assembly
regulation of mitotic spindle assembly
endosomal transport
protein transport
septum digestion after cytokinesis
mitotic metaphase plate congression
regulation of receptor recycling
lysosome organization
vacuolar transport
ESCRT III complex disassembly
GO:0015915 transport
midbody abscission
cellular response to lipopolysaccharide
cellular response to muramyl dipeptide
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_016410
NM_001195536

NM_029814

RefSeq (bjelančevina)

NP_001182465
NP_057494

NP_084090

Lokacija (UCSC)n/aChr 4: 40.95 – 40.97 Mb
PubMed pretraga[2][3]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Naelektrizirani multivezikulski tjelesni protein 5 je protein koji je kod ljudi kodiran genom CHMP5.[4][5][6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 219 aminokiselina, а molekulska težina 24.571 Da.[7]

1020304050
MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIK
KMREGPAKNMVKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLK
DTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMMEDANEIQEALS
RSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEGVPTDT
KNKDGVLVDEFGLPQIPAS

Funkcija

CHMP5 pripada porodici hromatin-modificirajućih proteina/porodica nabijenih multivazikulskih tjelesnih proteina (CHMP). Ovi proteini su komponente ESCRT-III (kompleks endosomnog sortiranja potreban za transport III), kompleksa uključenog u razgradnju površinskih receptorskih proteina i formiranje endocitnih multivezikulnih tijela (MVB). Neki CHMP-i imaju i jedarnu i citoplazmatsku/vezikulnu raspodjelu, a jedan takav CHMP, CHMP1A, potreban je i za stvaranje MVB-a i za regulaciju progresije ćelijskog ciklusa.[6][8]

Reference

  1. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000028419 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ Ward DM, Vaughn MB, Shiflett SL, White PL, Pollock AL, Hill J, Schnegelberger R, Sundquist WI, Kaplan J (Mar 2005). "The role of LIP5 and CHMP5 in multivesicular body formation and HIV-1 budding in mammalian cells". J Biol Chem. 280 (11): 10548–55. doi:10.1074/jbc.M413734200. PMID 15644320.
  5. ^ Howard TL, Stauffer DR, Degnin CR, Hollenberg SM (Sep 2001). "CHMP1 functions as a member of a newly defined family of vesicle trafficking proteins". J Cell Sci. 114 (Pt 13): 2395–404. doi:10.1242/jcs.114.13.2395. PMID 11559748.
  6. ^ a b "Entrez Gene: CHMP5 chromatin modifying protein 5".
  7. ^ "UniProt, Q9NZZ3". Pristupljeno 7. 9. 2021.
  8. ^ Tsang HT, Connell JW, Brown SE, Thompson A, Reid E, Sanderson CM (septembar 2006). "A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex". Genomics. 88 (3): 333–46. doi:10.1016/j.ygeno.2006.04.003. PMID 16730941.

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.