CDNF

CDNF
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2LPN, 2W50, 4BIT

Identifikatori
AliasiCDNF
Vanjski ID-jeviOMIM: 611233 MGI: 3606576 HomoloGene: 27965 GeneCards: CDNF
Lokacija gena (čovjek)
Hromosom 10 (čovjek)
Hrom.Hromosom 10 (čovjek)[1]
Hromosom 10 (čovjek)
Genomska lokacija za CDNF
Genomska lokacija za CDNF
Bend10p13Početak14,819,245 bp[1]
Kraj14,838,575 bp[1]
Lokacija gena (miš)
Hromosom 2 (miš)
Hrom.Hromosom 2 (miš)[2]
Hromosom 2 (miš)
Genomska lokacija za CDNF
Genomska lokacija za CDNF
Bend2|2 A1Početak3,514,067 bp[2]
Kraj3,527,413 bp[2]
Ontologija gena
Molekularna funkcija growth factor activity
Ćelijska komponenta extracellular region
Vanćelijsko
Endoplazmatski retikulum
Biološki proces neuron projection development
dopaminergic neuron differentiation
regulation of signaling receptor activity
GO:0072468 Transdukcija signala
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001029954

NM_177647

RefSeq (bjelančevina)

NP_001025125

NP_808315

Lokacija (UCSC)Chr 10: 14.82 – 14.84 MbChr 2: 3.51 – 3.53 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Cerebralni dopaminski neurotrofilni faktor, znan i kao ARMET-liki protein 1 jest protein koji je kod ljudi kodiran genom CDNF.[5][6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 187 aminokiselina, а molekulska težina 20.969.5[7]

1020304050
MWCASPVAVVAFCAGLLVSHPVLTQGQEAGGRPGADCEVCKEFLNRFYKS
LIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVT
RPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQI
LHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000185267 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000039496 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: Cerebral dopamine neurotrophic factor".
  6. ^ Lindholm P, Voutilainen MH, Laurén J, Peränen J, Leppänen VM, Andressoo JO, Lindahl M, Janhunen S, Kalkkinen N, Timmusk T, Tuominen RK, Saarma M (Jul 2007). "Novel neurotrophic factor CDNF protects and rescues midbrain dopamine neurons in vivo". Nature. 448 (7149): 73–7. doi:10.1038/nature05957. PMID 17611540. S2CID 4409832.
  7. ^ "UniProt, Q49AH0". Pristupljeno 31. 8. 2021.

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.