CAAX

CAAX
Identifikatori
AliasiRTL8C
Vanjski ID-jeviOMIM: 300213 MGI: 1920115 HomoloGene: 124163 GeneCards: RTL8C
Lokacija gena (čovjek)
Hromosom X
Hrom.Hromosom X[1]
Hromosom X
Genomska lokacija za CAAX
Genomska lokacija za CAAX
BendXq26.3Početak135,032,355 bp[1]
Kraj135,033,546 bp[1]
Lokacija gena (miš)
Hromosom X (miš)
Hrom.Hromosom X (miš)[2]
Hromosom X (miš)
Genomska lokacija za CAAX
Genomska lokacija za CAAX
BendX|X A5Početak52,609,999 bp[2]
Kraj52,610,399 bp[2]
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
Ćelijska komponenta membrana
ćelijska membrana
ćelijska komponenta
Biološki proces GO:0022610 biološki proces
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_003928
NM_001078171

NM_028375

RefSeq (bjelančevina)

NP_001071639

NP_082651

Lokacija (UCSC)Chr X: 135.03 – 135.03 MbChr X: 52.61 – 52.61 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

CAAX boksni protein 1 je protein koji je kod ljudi kodiran genom FAM127A.[5][6][7][8]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 113 aminokiselina, а molekulska težina 13.171 Da.[9]

1020304050
MDGRVQLIKALLALPIRPATRRWRNPIPFPETFDGDTDRLPEFIVQTGSY
MFVDENTFSSDALKVTFLITRLTGPALQWVIPYIKKESPLLNDYRGFLAE
MKRVFGWEEDEDF

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000134590 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000051851 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Frattini A, Faranda S, Zucchi I, Vezzoni P (Jan 1998). "A low-copy repeat in Xq26 represents a novel putatively prenylated protein gene (CXX1) and its pseudogenes (DXS9914, DXS9915, and DXS9916)". Genomics. 46 (1): 167–9. doi:10.1006/geno.1997.5006. PMID 9403077.
  6. ^ Brandt J, Schrauth S, Veith AM, Froschauer A, Haneke T, Schultheis C, Gessler M, Leimeister C, Volff JN (Apr 2005). "Transposable elements as a source of genetic innovation: expression and evolution of a family of retrotransposon-derived neogenes in mammals". Gene. 345 (1): 101–11. doi:10.1016/j.gene.2004.11.022. PMID 15716091.
  7. ^ Brandt J, Veith AM, Volff JN (Aug 2005). "A family of neofunctionalized Ty3/gypsy retrotransposon genes in mammalian genomes". Cytogenet Genome Res. 110 (1–4): 307–17. doi:10.1159/000084963. PMID 16093683.
  8. ^ "Entrez Gene: FAM127A family with sequence similarity 127, member A".
  9. ^ "UniProt, A6ZKI3". Pristupljeno 13. 9. 2021.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.