ARPC3

ARPC3
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2P9N, 1TYQ, 1U2V, 4JD2, 3DXK, 3UKU, 3UKR, 2P9P, 2P9K, 2P9U, 3ULE, 3RSE, 2P9S, 2P9I, 4XF2, 2P9L, 1K8K, 3DXM, 4XEI

Identifikatori
AliasiARPC3
Vanjski ID-jeviOMIM: 604225 MGI: 1928375 HomoloGene: 4178 GeneCards: ARPC3
Lokacija gena (čovjek)
Hromosom 12 (čovjek)
Hrom.Hromosom 12 (čovjek)[1]
Hromosom 12 (čovjek)
Genomska lokacija za ARPC3
Genomska lokacija za ARPC3
Bend12q24.11Početak110,434,823 bp[1]
Kraj110,450,422 bp[1]
Lokacija gena (miš)
Hromosom 5 (miš)
Hrom.Hromosom 5 (miš)[2]
Hromosom 5 (miš)
Genomska lokacija za ARPC3
Genomska lokacija za ARPC3
Bend5|5 FPočetak122,529,941 bp[2]
Kraj122,552,247 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija actin filament binding
structural constituent of cytoskeleton
GO:0001948, GO:0016582 vezivanje za proteine
actin binding
Ćelijska komponenta citoplazma
citosol
projekcija ćelije
membrana
focal adhesion
arp2/3 protein complex
actin cytoskeleton
Egzosom
citoskelet
lamellipodium
cell leading edge
filamentous actin
growth cone leading edge
jedro
site of double-strand break
Biološki proces Fc-gamma receptor signaling pathway involved in phagocytosis
ephrin receptor signaling pathway
regulation of actin filament polymerization
Arp2/3 complex-mediated actin nucleation
cellular response to nerve growth factor stimulus
membrane organization
actin polymerization-dependent cell motility
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001287222
NM_001278556

NM_019824

RefSeq (bjelančevina)

NP_001265485
NP_001274151

NP_062798

Lokacija (UCSC)Chr 12: 110.43 – 110.45 MbChr 5: 122.53 – 122.55 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš
Podjedinica ARPC3 (21 kDa) kompleksa ARP2/3
Kristalna struktura kompleksa arp2/3 sa vezanim adp i kalcijem
Identifikatori
SimbolP21-Arc

Podjedinica 3 aktinu-srodnog dvotrećinskog proteinskog kompleksa je protein koji je kod ljudi kodiran genom ARPC3.[5][6][7]

Ovaj gen kodira jednu od sedam podjedinica Arp2/3 proteinskog kompleksa. Proteinski kompleks Arp2/3 uključen je u kontrolu polimerizacije aktina i evolucijski je konzerviran. Tačna uloga podjedinice p21 proteina kodiranog ovim genom, tek treba biti utvrđena.[7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 178 aminokiselina, a molekulska težina 20.547 Da.[8].

1020304050
MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFK
ANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGI
TNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFD
PQNDKPSKWWTCFVKRQFMNKSLSGPGQ

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000111229 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000029465 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Welch MD, DePace AH, Verma S, Iwamatsu A, Mitchison TJ (Aug 1997). "The human Arp2/3 complex is composed of evolutionarily conserved subunits and is localized to cellular regions of dynamic actin filament assembly". J Cell Biol. 138 (2): 375–84. doi:10.1083/jcb.138.2.375. PMC 2138188. PMID 9230079.
  6. ^ Machesky LM, Reeves E, Wientjes F, Mattheyse FJ, Grogan A, Totty NF, Burlingame AL, Hsuan JJ, Segal AW (Jan 1998). "Mammalian actin-related protein 2/3 complex localizes to regions of lamellipodial protrusion and is composed of evolutionarily conserved proteins". Biochem J. 328 (1): 105–12. doi:10.1042/bj3280105. PMC 1218893. PMID 9359840.
  7. ^ a b "Entrez Gene: ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa".
  8. ^ "UniProt, O15145". Pristupljeno 6. 8. 2021.

Dopunska literatura

Vanjski linkovi

ARPC3 detalji ljudskog genoma u UCSC Genome Browser.

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.