ADIPOR1

ADIPOR1
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

3WXV

Identifikatori
AliasiADIPOR1
Vanjski ID-jeviOMIM: 607945 MGI: 1919924 HomoloGene: 69199 GeneCards: ADIPOR1
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za ADIPOR1
Genomska lokacija za ADIPOR1
Bend1q32.1Početak202,940,826 bp[1]
Kraj202,958,572 bp[1]
Lokacija gena (miš)
Hromosom 1 (miš)
Hrom.Hromosom 1 (miš)[2]
Hromosom 1 (miš)
Genomska lokacija za ADIPOR1
Genomska lokacija za ADIPOR1
Bend1|1 E4Početak134,343,116 bp[2]
Kraj134,361,089 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija adipokinetic hormone receptor activity
adiponectin binding
vezivanje iona metala
vezivanje identičnih proteina
protein heterodimerization activity
protein kinase binding
signaling receptor activity
Ćelijska komponenta integral component of membrane
membrana
intrinsic component of plasma membrane
ćelijska membrana
Biološki proces glucose homeostasis
lipid metabolism
leptin-mediated signaling pathway
adiponectin-activated signaling pathway
fatty acid metabolic process
regulation of lipid metabolic process
regulation of glucose metabolic process
negative regulation of cell growth
fatty acid oxidation
hormone-mediated signaling pathway
GO:1903106 positive regulation of insulin receptor signaling pathway
positive regulation of receptor signaling pathway via JAK-STAT
negative regulation of epithelial to mesenchymal transition
negative regulation of receptor signaling pathway via JAK-STAT
negative regulation of epithelial cell migration
negative regulation of NIK/NF-kappaB signaling
G protein-coupled receptor signaling pathway
regulation of fatty acid biosynthetic process
positive regulation of cold-induced thermogenesis
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001290553
NM_001290557
NM_001290629
NM_015999

NM_028320
NM_001306069

RefSeq (bjelančevina)

NP_001277482
NP_001277486
NP_001277558
NP_057083

NP_001292998
NP_082596

Lokacija (UCSC)Chr 1: 202.94 – 202.96 MbChr 1: 134.34 – 134.36 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Adiponektinski receptor 1 (AdipoR1) jest protein koji je kod ljudi kodiran genom ADIPOR1 sa hromosoma 1.[5] Član je porodice progestini i adipoQ receptori (PAQR), a poznat je i kao PAQR1.[6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 375 aminokiselina, a molekulska težina 42.616 Da.[7]

1020304050
MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEE
EQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVL
PDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLF
LGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKV
SRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAI
IVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQM
GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFV
HFYGVSNLQEFRYGLEGGCTDDTLL

Struktura

Slično G-protein spregnutim receptorima (GPCR), AdipoR1 također ima sedam transmembranskih domena. Međutim, AdipoR1 je orijentiran suprotno od GPCR u membrani (tj., citoplazmatski N-terminal, vanćelijski C-terminal) i ne povezuje se sa G-proteinima.[5]

Funkcija

Adiponektinski receptori, AdipoR1 i AdipoR2, služe kao receptori za globulasti i punodužinski adiponektin i posreduju u povećanju razine AMP-aktivirane protein-kinaze (AMPK) i PPAR-α aktivnosti liganda, kao i oksidaciji masnih kiselima i uzimanju glukoze za adiponektin.[5][8] Univerzitet u Tokiju je 2016. objavio da pokreće istragu o anonimnim tvrdnjama o izmišljenim i falsifikovanim podacima o identifikaciji AdipoR1 i AdipoR2.[9]

Agonisti

Peptidi

Nepeptidi

Antagonisti

Peptid

Također pogledajte

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000159346 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000026457 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b c Yamauchi T, Kamon J, Ito Y, Tsuchida A, Yokomizo T, Kita S, Sugiyama T, Miyagishi M, Hara K, Tsunoda M, Murakami K, Ohteki T, Uchida S, Takekawa S, Waki H, Tsuno NH, Shibata Y, Terauchi Y, Froguel P, Tobe K, Koyasu S, Taira K, Kitamura T, Shimizu T, Nagai R, Kadowaki T (juni 2003). "Cloning of adiponectin receptors that mediate antidiabetic metabolic effects". Nature. 423 (6941): 762–9. Bibcode:2003Natur.423..762Y. doi:10.1038/nature01705. PMID 12802337. S2CID 52860797.
  6. ^ Tang YT, Hu T, Arterburn M, Boyle B, Bright JM, Emtage PC, Funk WD (septembar 2005). "PAQR proteins: a novel membrane receptor family defined by an ancient 7-transmembrane pass motif". Journal of Molecular Evolution. 61 (3): 372–80. Bibcode:2005JMolE..61..372T. doi:10.1007/s00239-004-0375-2. PMID 16044242. S2CID 31473802.
  7. ^ "UniProt, Q96A54" (jezik: en.). Pristupljeno 6. 12. 2021.CS1 održavanje: nepoznati jezik (link)
  8. ^ "Entrez Gene: ADIPOR1 adiponectin receptor 1".
  9. ^ University of Tokyo to investigate data manipulation charges against six prominent research groups ScienceInsider, Dennis Normile, Sep 20, 2016
  10. ^ a b c Otvos L, Knappe D, Hoffmann R, Kovalszky I, Olah J, Hewitson TD, Stawikowska R, Stawikowski M, Cudic P, Lin F, Wade JD, Surmacz E, Lovas S (2014). "Development of second generation peptides modulating cellular adiponectin receptor responses". Frontiers in Chemistry. 2: 93. Bibcode:2014FrCh....2...93O. doi:10.3389/fchem.2014.00093. PMC 4201147. PMID 25368867.
  11. ^ Okada-Iwabu M, Yamauchi T, Iwabu M, Honma T, Hamagami K, Matsuda K, Yamaguchi M, Tanabe H, Kimura-Someya T, Shirouzu M, Ogata H, Tokuyama K, Ueki K, Nagano T, Tanaka A, Yokoyama S, Kadowaki T (novembar 2013). "A small-molecule AdipoR agonist for type 2 diabetes and short life in obesity". Nature. 503 (7477): 493–9. Bibcode:2013Natur.503..493O. doi:10.1038/nature12656. PMID 24172895. S2CID 4447039.
  12. ^ a b c d Sun Y, Zang Z, Zhong L, Wu M, Su Q, Gao X, Zan W, Lin D, Zhao Y, Zhang Z (2013). "Identification of adiponectin receptor agonist utilizing a fluorescence polarization based high throughput assay". PLOS ONE. 8 (5): e63354. Bibcode:2013PLoSO...863354S. doi:10.1371/journal.pone.0063354. PMC 3653934. PMID 23691032.

Dopunska literatura

Vanjski linkovi


Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.