DOKUMEN123.COM

responsible for defensin production are highly polymorphic.[citation needed] Vertebrate defensins are primarily α-defensins and β-defensins. Some primates...

Plant defensins (formerly gamma-thionins) are a family of primitive, highly stable, cysteine-rich defensins found in plants that function to defend them...

functioning to protect. Human Paneth cells produce two α-defensins known as human α-defensin HD-5 (DEFA5) and HD-6 (DEFA6). HD-5 has a wide spectrum of...

convergent evolution of venom genes from existing immune system genes (defensins). A unique feature of the venom is the presence of a D-amino acid. This...

Theta-defensins (θ-defensins, retrocyclins, or demidefensins) are a family of mammalian antimicrobial peptides. They are found in non-human 'Old World'...

Arthropod defensins are a family defensin proteins found in mollusks, insects, and arachnids. These cysteine-rich antibacterial peptides are primarily...

Beta-defensin 1 is a protein that in humans is encoded by the DEFB1 gene. Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils...

are part of the reproductive system in women. Defensins alpha-Defensins beta-Defensins theta-defensins Cathelicidins LL-37 Whey acid proteins SLPI Elafin...

Alpha defensins are a family of mammalian defensin peptides of the alpha subfamily. They are also known as cryptdins and are produced within the small...

for the discrepancy. Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar...

neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: Alpha defensins, Beta defensins and Theta...

Beta defensins are a family of vertebrate defensins. The beta defensins are antimicrobial peptides implicated in the resistance of epithelial surfaces...

family of plant defensins rupture membranes by identifying key phospholipids in the cell membranes of the pathogen. Human defensins have been thought...

These mechanisms include phagocytosis, antimicrobial peptides called defensins, RNA interference, and the complement system. Jawed vertebrates, including...

which are defensins, are part of the innate immune response and are common to most higher forms of life. As brilacidin is modeled after a defensin, it is...

contains a powerful venom in the male platypus. This venom is derived from β-defensins, proteins that are present in mammals that create holes in viral and bacterial...

immunity. Several species of insect produce antimicrobial peptides known as defensins and cecropins. In invertebrates, PRRs trigger proteolytic cascades that...

anti-microbial defensins that fuse with phagocytic vacuoles. Azurophils may contain myeloperoxidase, phospholipase A2, acid hydrolases, elastase, defensins, neutral...

Myeloperoxidase, bactericidal/permeability-increasing protein (BPI), defensins, and the serine proteases neutrophil elastase, Proteinase 3 and cathepsin...

encoded by the DEFA1 gene. Human alpha defensin 1 belongs to the alpha defensin family of antimicrobial peptides. Defensins are a family of microbicidal and...

using MHB are not applicable to antimicrobial agents such as defensins, because defensins must be incubated in a low salt buffer, not rich broth, in order...

epithelial cells called Paneth cells secrete abundant quantities human α-defensins into the intestinal lumen of healthy individuals. Lysozyme is another...

States CSαβ (Cysteine-stabilized alpha beta) defensins, a superfamily of proteins, also called cis-defensins This disambiguation page lists articles associated...

antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides...

containing a strain of R. mucosa called RSM 2015 under the brand name Skinesa Defensin. Han XY, Pham AS, Tarrand JJ, Rolston KV, Helsel LO, Levett PN. Bacteriologic...

Beta-defensin 3 is a protein that in humans is encoded by the DEFB3 gene. HBD-3 was first isolated from human lesional psoriatic scales. RT-PCR showed...

gene. DEFA6 is expressed in the Paneth cells of the ileum. The alpha defensins are a family of microbicidal and cytotoxic peptides that defend the host...

defensins have commonalities in their molecular structure, such as cysteines in the peptide stabilized with disulfide bonds. In particular, defensins...

neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins...

secrete mucus which also contains several antimicrobial compounds such as defensins, antiproteases, and antioxidants. The size of the respiratory tract and...

pain) that can last as long as months. The venom is composed largely of defensin-like proteins (DLPs) produced by the immune system, some of which are unique...

the DEFA5 gene. DEFA5 is expressed in the Paneth cells of the ileum. Defensins are a family of microbicidal and cytotoxic peptides (antimicrobial peptides;...

bacteria and viruses. Defensins are a peptide family of cytotoxic microbicides involved in innate immunity. Members of the defensin family are distinguished...

Whittington, C. M.; Papenfuss, A. T.; Bansal, P.; et al. (June 2008). "Defensins and the convergent evolution of platypus and reptile venom genes". Genome...

neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins...

intestinal glands and release antimicrobial substances such as alpha defensins and lysozyme; microfold cells, which take up and transport antigens from...

extrinsic blood coagulation cascade. The enzymes lysozyme and peroxidase, defensins, cystatins and an antibody, IgA, are all antibacterial. Thrombospondin...

lubricates and waterproofs the outer layer of the skin, the stratum corneum. Defensins are substances that are secreted onto the skin surface that are anti-microbial...

CBD103 (KB) have a black coat resulting from the interaction between a β-defensin and MC1R (black Curly Coated Retriever, bottom)." — Candille, Kaelin, et...

the lungs. These include secretory immunoglobulins (IgA), collectins, defensins and other peptides and proteases, reactive oxygen species, and reactive...

bacteria: Lysozyme Salivary lactoperoxidase Lactoferrin Immunoglobulin A Beta defensin Proline-rich proteins (function in enamel formation, Ca2+-binding, microbe...

in more mature cells). Primary granules contain cationic proteins and defensins that are used to kill bacteria, proteolytic enzymes and cathepsin G to...

Beta-defensin 129 is a protein that in humans is encoded by the DEFB129 gene. Defensins are cysteine-rich cationic polypeptides that are important in the...

similar structure but are an unrelated class of protein, now called plant defensins. The proteins are toxic to animal cells, presumably attacking the cell...

encoded by the DEFA3 gene. Human alpha defensin 3 belongs to the alpha defensin family of antimicrobial peptides. Defensins are a family of microbicidal and...

permeability-increasing protein, Major basic protein and cationic proteins such as defensins. Other antimicrobial peptides are present in these granules, including...

Polysaccharides are associated with adhesion of neutrophil-secreted defensins that inactivate and degrade the bacteria. By not containing this macromolecule...

S2CID 205309084. Hollox EJ, Barber JC, Brookes AJ, Armour JA (2008). "Defensins and the dynamic genome: what we can learn from structural variation at...

political alliance in the Philippines Human neutrophil peptides or alpha defensins 1-4 This disambiguation page lists articles associated with the title...

C-reactive protein, ferritin, various interleukins, chemokines, cytokines, defensins, and bacteria, have been shown to be associated with increased risks of...

the major allergen of mugwort pollen, is a modular glycoprotein with a defensin-like and a hydroxyproline-rich domain". The FASEB Journal. 17 (1): 106–8...

PMC 122330. PMID 11854508. "Entrez Gene: DEFB119 defensin, beta 119". Lehrer RI, Ganz T (2002). "Defensins of vertebrate animals". Curr. Opin. Immunol. 14...

also found in Drosophila defensin, and some plant defensins. Drosomycin has greater sequence similarity with these plant defensins (up to 40%), than with...

it was discovered that a gene mutation responsible for the protein beta-defensin 3 is responsible for the black coat color in dogs. The same mutation was...

virions, whereas apoptosis leads to destruction of the virus inside. α-defensins, antimicrobial molecules, are also secreted by NK cells, and directly...

Moens U, McCray PB, Stenfors LE, Seljfelid R (September 1999). "Human beta-defensin-1 mRNA is transcribed in tympanic membrane and adjacent auditory canal...

Claudio; Bruin, Gerard; Polus, Florine; Aigner, Birgit (March 2017). "β-Defensin 2 is a responsive biomarker of IL-17A–driven skin pathology in patients...

TAS2R fixed immune system. The innate immune system uses nitric oxide and defensins which are capable of destroying bacteria, and also viruses. These fixed...

It was discovered that a gene mutation responsible for the protein beta-defensin 3, known as the K locus, is responsible for the black coat colour in dogs...

immunoregulatory responses by regulation of cytokines, antimicrobial peptides defensins, and take an active part in increased restitution of wound in the colon...

for use in the food industry for food preservation. defensins plectasin, the first fungal defensin discovered 2005 Essig A, Hofmann D, Münch D, et al....

antimicrobial peptides, AMPs, that display limited sequence similarity to certain defensins and tachyplesins. In solution, the peptides fold to form an anti-parallel...

much less expensive than testing for alpha-defensin. Enzyme List of enzymes Ester Biomarker Alpha-defensin Kiss MO, Massé V (2023). "Biomarkers of periprosthetic...

signaling functions. Magainin family Cecropin family Cathelicidin family Defensin family Substance P Kassinin Neurokinin A Eledoisin Neurokinin B VIP (Vasoactive...

tachycardia. The defensins employed by O. savignyi are being studied for developing multifunctional peptides - shorter peptides derived from the defensin isoform...

immunoregulatory responses by regulation of cytokines, antimicrobial peptides defensins, and take an active part in increased restitution of wound in the colon...

LW, Yang D (November 2003). "Roles of antimicrobial peptides such as defensins in innate and adaptive immunity". Annals of the Rheumatic Diseases. 62...

Beta-defensin 127 is a protein that in humans is encoded by the DEFB127 gene. Defensins are cysteine-rich cationic polypeptides that are important in the...

platelets release reactive oxygen species (ROS), antimicrobial peptides, defensins, kinocidins and proteases, killing the bacteria directly. Platelets also...

epithelial cells) and tumor necrosis factor (TNF)-α to produce both IL-6 and defensins. Of these, the former is found to combine synergistically with other interleukins...

antimicrobial peptides (AMPs), including human cathelicidin LL-37, β-defensins, lipocalin 2 and hepcidin. These peptides, together with the enzyme indoleamine...

USP17L7 Name Basis Function DEFB106A Beta-defensin 106A Textmining and Co-expression Belongs to the defensin family which are antimicrobial and cytotoxic...

Calomera species littoralis. Identification, structural characterisation and expression analysis of a defensin gene from the tiger beetle Calomera littoralis...

"Oral mucosal expression of HIV-1 receptors, co-receptors, and alpha-defensins: tableau of resistance or susceptibility to HIV infection?". Advances...

activated the epithelial cells in culture to produce beta-defensin 2 (hBD2) and beta defensins 4 (hBD4). These findings suggest that TFF can activate intestinal...

Ponting, CP; Temple-Smith, P; Warren, WC; Kuchel, PW; Belov, K (Jun 2008). "Defensins and the convergent evolution of platypus and reptile venom genes". Genome...

factor that regulates the production of cytokines like IL-1, TNF-a, and defensins, although its function in apoptosis may be separate from this function...

In 2017, researchers genetically modified a virus to express spinach defensin proteins. The virus was injected into orange trees to combat citrus greening...

Defensin, alpha 1B a human protein that is encoded by the DEFA1B gene. defensin ENSG00000285176 GRCh38: Ensembl release 89: ENSG00000240247, ENSG00000285176...

pyrophosphate. Lipid II interacts with human alpha defensins, a class of antimicrobial peptides, such as Defensin, alpha 1. The latter has been used to describe...

Song 2006 also found an inhibitor of κB (IκB). AiBD is the first big defensin cloned from this scallop. The gene is 531 nucleotides and the polypeptide...

platform grant to study the structure-activity relationships of Beta defensins. She works with Cait MacPhee, Garth Cooper and Tilo Kunath on neurodegenerative...

rRNA N-glycosidase activity. The carboxy-terminal amino acid sequence of defensins, which is distinguished by the presence of two antiparallel -strands with...

use include methylglyoxal, hydrogen peroxide, and royalisin (also called defensin-1). For chronic and acute coughs, a Cochrane review found no strong evidence...

pathway, which is essential for activation of antimicrobial peptides, defensins, and cecropins that help to inhibit virus proliferation. Conversely, certain...

barrier to microbes by the synthesis of antimicrobial peptides (beta-defensins and cathelicidins) and immunoglobulins. Terminally differentiated, superficial...

Beta-defensin 126 is a protein that in humans is encoded by the DEFB126 gene. Defensins are cysteine-rich cationic polypeptides that are important in the...

(2006) 1408-1425. Dhople V, Krukemeyer A, Ramamoorthy A, The human beta-defensin-3, an antibacterial peptide with multiple biological functions, Biochim...

PMID 15033915. "Entrez Gene: DEFB118 defensin, beta 118". van Wetering S, Sterk PJ, Rabe KF, Hiemstra PS (Dec 1999). "Defensins: key players or bystanders in...

star located at (J2000.0; 00h 05m 10.1829s; +02° 23′ 49.949″) Human Alpha Defensin 5, the DEFA5 gene product This disambiguation page lists articles associated...

effective stimulant of expression of human beta-defensin-1 (hBD-1). This protein is a member of the beta-defensin family of proteins that bridges innate and...

Smith DG, Li Y, Yang M, Zhu Q (June 2014). "Evolution of primate α and θ defensins revealed by analysis of genomes". Molecular Biology Reports. 41 (6): 3859–66...

contents. Most common & well studied defensins synthesised by the odontoblast process are the human-ß defensins (hBDs) -1, -2, -3 and -4 which vary in...

activity, agouti and agouti-related protein (AgRP). Lastly, the ligand β-defensin 3 acts as a neutral melanocortin receptor antagonist. The five melanocortin...

project took samples from 38 different breeds to find the gene (a beta defensin gene) responsible for dog coat color. One version produces yellow dogs...

the eye) is, instead, protected by secreted enzymes, mainly lysozyme and defensin. However, when these protective barriers fail, conjunctivitis results.[citation...

downregulate antimicrobial peptides on the skin like cathelicidin LL-37, human β-defensin 2 and 3. Xylene and formaldehyde worsen allergic inflammation in animal...

toll-like receptors (TLRs) prevents pro-inflammatory cytokine expression beta defensins bioactive peptides recruit T cells and enhance TLRs chondroitin sulfate...

European and Middle Eastern wolves showing contributions from dogs. The β-defensin gene responsible for the black coat of North American wolves was the result...

proliferation and synthesis of antimicrobials including S100, Reg3β, Reg3γ and defensins. It is also thought to play a role in regulating lipid metabolism, glucose...

cells do a variety of tasks including recruiting neutrophils, creating defensins, and mediating inflammation in the intestinal epithelium and skin. TH2...

has a cytolytic and/or antimicrobial activity similar to that of insect defensins), and a C-terminal region with a CSαβ motif, which causes potassium channel-blocking...

four antibacterial peptide genes - apidaecin, hymenoptaecin, abaecin, and defensin - were isolated and cloned from B. ignitus. Synthesized abaecin has been...

Papenfuss AT, Bansal P, Torres AM, Wong ES, Deakin JE, et al. (June 2008). "Defensins and the convergent evolution of platypus and reptile venom genes". Genome...

chemokines. One important antimicrobial agent produced by odontoblasts is beta-defensins (BDs). BDs kill microorganisms by forming micropores that destroy membrane...

peptide FPR1 mROS NLRP3 Endoplasmic reticulum Calreticulin CD91 Granule Defensins TLR4 Cathelicidin (LL37) P2X7, FPR2 Eosinophil-derived neurotoxin TLR2...

of the innate immune system of countless organisms. Plant AMPs such as defensins, thionins, and cyclotides have been investigated as alternatives to conventional...

repressor that is a product of the Agouti gene (A locus), and an activator, β-Defensin 103 (CBD103), recently named the K locus. In Labradors a highly-active...

Kimberly RP (Dec 2003). "Fc gamma RIIIb allele-sensitive release of alpha-defensins: anti-neutrophil cytoplasmic antibody-induced release of chemotaxins"...

Novozymes. Plectasin belongs to the antimicrobial peptide class called fungal defensins, which is also present in invertebrates such as flies and mussels.[citation...

hydrolytic enzymes including elastase, myeloperoxidase, cathepsins, and defensins that aid in pathogen destruction. Secondary granules, or specific granules...

keratin), enzymes (e.g. proteases), lipids, and antimicrobial peptides (defensins) contribute to maintain the important barrier function of the skin. Keratinization...

putative cysteines, other putative components of the venom such as protease, defensins and serine proteases were identified, glycine-rich proteins (GRP) were...

PMC 3091649. PMID 20663230. Mngyue, Lv (2016). "A Family of CSαβ Defensins and Defensin-Like Peptides from the Migratory Locust, Locusta migratoria, and...

Ustilago esculenta stimulates innate immune system, via induction of human β-defensin-2. Archived 1 June 2018 at the Wayback Machine ISHS Acta Horticulturae...

secretes a small molecule AMP which leads to increased expression of Human β-defensins. S. epidermidis also stimulates IL-17A+ CD8+ T cells production that increases...

family member 1 (ACSL1) and defensin beta 1. ACSL1 is thought to play a role in the processing of ghrelin while defensin beta 1 produces a protein that...

fiber protein 3-like protein 1 Active in cytoskeleton DEFB30 Beta-defensin 130a; Defensin, beta 130 Antimicrobial host-defense peptide, antiplasmodial activity...

been exposed to some classes of antibiotics, and antibacterial peptides (defensins). The appearance of these mesosome-like structures may be the result of...

Proteins numbered by IUIS include: Gly m 1, a hydrophobic protein Gly m 2, defensin Gly m 3, profilin Gly m 4, PR-10 Gly m 5, vicilin, a cupin Gly m 6, legumin...

DEAD box polypeptide 27 DEFB118, DEFB119, DEFB126, DEFB127, DEFB129: Beta-defensin genes DLGAP4: Disks large-associated protein 4 DNAJC5: Cysteine string...

drive infiltration of macrophages and antimicrobial products, for example defensins and mucins. All these products contribute to the development of inflammation...

carbon, metals, silicon, or peptides, such as nanonets composed of the defensin HD6. The word nanonet is also used in reference to a nanoscale communication...

differentiation of Th17 cells IL-22 T helper 17 cells (Th17) IL22R Production of defensins from epithelial cells. Activates STAT1 and STAT3 and increases production...

Cytryńska, M (2012). "Anti-Legionella dumoffii activity of Galleria mellonella defensin and apolipophorin III". Int J Mol Sci. 13 (12): 17048–64. doi:10.3390/ijms131217048...

inducing the production of peptides related to innate defense, such as defensins and cytokines. PARs are activated by the action of serine proteases such...

does not involve cell membrane permeabilization, which is typical for defensins and other antimicrobial peptides, cell wall hydrolysis, or osmotic shock...

the chemokine MIP-1alpha and its involvement with CD8+ T cells. Beta defensins, a family of antimicrobial peptides found in the respiratory tract, are...

retard the growth of bacteria.This is through the secretion of defensins (β-defensins (hBD-1 and hBD-2)) which are a unique feature of the sulcular epithelium...

antimicrobial activities, and primary structures of hamster neutrophil defensins". Infection and Immunity. 64 (11): 4444–9. doi:10.1128/IAI.64.11.4444-4449...

contains a synthetic sequence of anti-microbial peptides which mimic defensins (the bacteria-killing molecules naturally found in saliva. Though this...

Through its folding pattern, APETx1 is classified as a member of the Defensin family. APETx1 has an 88% homology with APETx4, another Anthopleura elegantissima...

antigens are represented for example by insulin from the pancreas or defensins from the gastrointestinal tract. Antigen-presenting cells (APCs) of the...

does not involve cell membrane permeabilization, which is typical for defensins and other antimicrobial peptides, cell wall hydrolysis, or osmotic shock...

Macaques Supports an Adaptive Role for Copy Number Variation of the b-Defensin-2 Gene". Genome Biology and Evolution. 6 (11): 3025–3038. doi:10.1093/gbe/evu236...

infection. Since 2009 genetically modified viruses expressing spinach defensin proteins have been field trialed in Florida (USA). The virus infection...

progression. Perforin has been shown to interact with calreticulin. Granzymes Defensin Complement membrane attack complex GRCh38: Ensembl release 89: ENSG00000180644...

cells. Paneth cells produce antimicrobial peptides such as human alpha-defensin. Microfold cells (commonly referred to as M cells) sample antigens from...

is a specific quality of the proteins from the mentioned family. Both defensins and venom toxins, like Cm28, share a structural similarity. Both are cysteine-rich...

cell early also keeps the bacteria from being destroyed by lysosomal defensins and other pathogen-killing agents. MNGCs may help protect the bacteria...

MTA2 is inhibited by the Rho GDIa in breast cancer cells and by human β-defensins in colon cancer cells. MicroRNAs-146a and miR-34a also regulate the levels...

does not involve cell membrane permeabilization, which is typical for defensins and other antimicrobial peptides, cell wall hydrolysis, or osmotic shock...

Suico MA, Shuto T, Li JD, Kai H (March 2004). "MEF up-regulates human beta-defensin 2 expression in epithelial cells". FEBS Letters. 561 (1–3): 117–21. Bibcode:2004FEBSL...

development, and seed development. Many CRPs function in plant defense. Defensins, a major class of CRP with an eight-cysteine motif forming four disulfide...

project took samples from 38 different breeds to find the gene (a beta defensin gene) responsible for dog coat color. One version produces yellow dogs...

Tachystatin A is thought to have an antimicrobial activity similar to defensins. Fujitani N, Kawabata S, Osaki T, Kumaki Y, Demura M, Nitta K, Kawano...

Crotamine is homologous with other venom myotoxins and is similar to α-,β-defensins. The amino acid sequence (YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG,...

inhibitors which protect against insect herbivores, other peptides activate defensins and modify root growth. They have also been shown to affect plants' responses...

glycine-rich, along with other polypeptides in Drosophila melanogaster such as Defensin, Cecropin, and Attacin. Further molecular genetic analysis revealed that...

will be largely absent in the granulocytes of these patients, along with defensins (despite these also being found in azurophilic (primary) granules). The...

porcine peptidoglycan recognition protein long isoforms: involvement in beta-defensin-1 expression". Infection and Immunity. 73 (11): 7133–7141. doi:10.1128/IAI...

S2CID 14563599. Yang D, Chertov O, Bykovskaia SN, et al. (1999). "Beta-defensins: linking innate and adaptive immunity through dendritic and T cell CCR6"...

skin, tears, mucus, saliva, Gastric acid, etc.) Antimicrobial peptides Defensins Lysozyme Inflammation Inflammatory reflex Inflammasome Granuloma Acute-phase...

Beta-defensin 103 is a protein that in humans is encoded by the DEFB103A gene. Defensins form a family of microbicidal and cytotoxic peptides made by...

region that included a long non-coding RNA and was near the genes for beta-defensins, which are antimicrobial peptides involved in immunity and wound healing...

"Agrimonia procera exerts antimicrobial effects, modulates the expression of defensins and cytokines in colonocytes and increases the immune response in...

presence of other A-series alleles. The alleles at the K locus (the β-Defensin 103 gene or DEFB103) determine the coloring pattern of an animal's coat...

as β-defensins, is a powerful mechanism that helps maintain intestinal homeostasis. An increase in IL-22 levels together with increased β-defensin expression...

Bykovskaia SN, Chen Q, Buffo MJ, Shogan J, et al. (October 1999). "Beta-defensins: linking innate and adaptive immunity through dendritic and T cell CCR6"...

PMID 15313546. Froy O, Gurevitz M (December 2003). "Arthropod and mollusk defensins--evolution by exon-shuffling". Trends in Genetics. 19 (12): 684–7. doi:10...

including ampicillin, rifampin, cefotaxime, as well as others. Magainin and defensin are natural peptides, short polymers composed of amino acids, which display...

accuracy in copy number variation: failure to replicate associations of beta-defensin copy number with Crohn's disease". Human Molecular Genetics. 19 (24): 4930–4938...

The innate immune system, which provides a preconfigured response (e.g. defensins, complement system) to broad groups of situations and stimuli; and the...

Michelle K.; Zhu, Hongjie; Jenkins, Gregory D. (January 10, 2018). "Beta-defensin 1, aryl hydrocarbon receptor and plasma kynurenine in major depressive...

nucleotide-gated channel alpha 1 Cyclin A1 Cytochrome P450, family 1, member A1 Defensin, alpha 1 Dystrophin-associated protein A1 Ephrin A1 Eukaryotic translation...

phytoalexins such as genistein or camalexin Antimicrobial proteins such as defensins, thionins, or PR-1 Antimicrobial enzymes such as chitinases, beta-glucanases...

healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa. MMP7 was initially characterized by Woessner et...

structure of charybdotoxin: common motifs in scorpion toxins and insect defensins". Science. 254 (5037): 1521–3. Bibcode:1991Sci...254.1521B. doi:10.1126/science...

infection: implication of naturally occurring human antimicrobial agents beta-defensins, cathelicidin LL-37 and lysozyme". J. Dermatol. Sci. 40 (3): 157–68. doi:10...

doi:10.1016/j.cell.2014.05.039. PMC 4104544. PMID 25036637. DEF107A Beta-defensin 107 Anti-bacterial activity XAGE1D Cancer/testis antigen family 12 member...

expression of PDF1.2a and PDF1.2b to reduce that of antimicrobial protein defensins. Furthermore, BES1 interacts with the transcription factors MYBs and reduces...

Hoffmann and T. Achstetter Expression and Secretion in Yeast of Active Insect Defensin, an Inducible Antibacterial Peptide from the Fleshfly Phormia terranovae...

of 635 nm and 405 nm, and by increasing TGF-β1 signaling and Human Beta Defensin-2 (HBD-2) expression. These effects promote soft tissue regeneration and...

Ranjan (2017-08-02). "Overexpression of biologically safe Rorippa indica defensin enhances aphid tolerance in Brassica juncea". Planta. 246 (5): 1029–1044...

synthesis such as pectin esterase, leucine-rich transmembrane kinase, plant defensin. The remainder of the downregulated genes comprised those involved in multiple...

Cammarota M, Alfano A, Schiraldi C, Donnarumma G (2017). "Beta-Defensin-2 and Beta-Defensin-3 Reduce Intestinal Damage Caused by Salmonella typhimurium Modulating...

genes recruited from other tissue groups (Acetylcholinesterase, crotasin, defensin & cystatin). Due to this extraordinary amount of variation in the components...

chitinase V (Q43576) Chitinase PR-12 IPR008176 Radish Rs-AFP3 (O24332) Plant Defensin PR-13 IPR001010 Arabidopsis THI2.1 (Q42596) Thionin PR-14 IPR000528 Lipid...

NLM. MeSH D12.644.050.200 – defensins MeSH D12.644.050.200.050 – alpha defensins MeSH D12.644.050.200.075 – beta defensins MeSH D12.644.120.700 – sincalide...

Transfer of sweet pepper genes coding for ferredoxin like protein and defensin was shown to reduce D. dadantii disease in Phalaenopsis orchids under cultivation...

resist bacteria. IL-17F has the ability to stimulate the production of defensins and other antimicrobial peptides; it can also resist bacteria through...

(NCR peptides). NCRs are antimicrobial peptides that are similar to the defensin peptides used in mammals in response to invading pathogens. The NCRs are...

highly expressed in basal cells. Other innate immune mediators include beta-defensin 2, and lipocalin-2; pro-inflammatory cytokines, interleukins IL6, and IL8;...

of similarity to beta-defensins, a family of antimicrobial peptides. The gene is located on chromosome 8p23 near the defensin gene cluster. Alternative...

PAR-2 receptors, of intestinal epithelial cells HT-29, and promotes beta-defensin-2 expression. Immunology letters, 123(1), 52-59. Agarwal PK (2005). "Role...

Drosophila, particularly: Diptericin, Attacin, Drosocin, Cecropin, and Defensin. The Imd pathway regulates hundreds of genes after infection, however the...

lasso proteins may also be functional. This concerns toxic, antimicrobial, defensin-like or immune system related with L1 motif The current list of experimentally...

Ustilago esculenta stimulates innate immune system, via induction of human β-defensin-2. ISHS Acta Horticulturae 841: II International Symposium on Human Health...

Cytokine Cytokine redundancy Cytokine storm Cytotoxicity DAMPs Danger model Defensin Degranulation Dendritic cell Dextran 1 Dispanin Dog leukocyte antigen Drug...

immunity: expression of the two major inducible antibacterial peptides, defensin and diptericin, in Phormia terranovae." EMBO J. 9: 2507-515. Green, A....

jasmonate/ethylene and salicylate defense hormones and induce the expression of PDF1.2 (defensin) gene being component of plant innate immune system. Expression of these...

porcine peptidoglycan recognition protein long isoforms: involvement in beta-defensin-1 expression". Infection and Immunity. 73 (11): 7133–41. doi:10.1128/IAI...

(November 2004). "Structure-activity relationships in defensin dimers: a novel link between beta-defensin tertiary structure and antimicrobial activity". The...

Frank; Pieber, Thomas Rudolf; Patel, Dhavalkumar D. (March 2017). "β-Defensin 2 is a responsive biomarker of IL-17A–driven skin pathology in patients...

the expression of pro-inflammatory cytokines, chemokines and human beta-defensin-2 in vaginal epithelial cells, MICROBES AND INFECTION 7: (9-10) pp. 1117–1127...

known as Pelophylax porosus) was used to isolate the unique non-hemolytic defensin known as brevinin-2R. Malignant cells such as T-cell leukemia Jurkat, B-cell...

Claudio; Bruin, Gerard; Polus, Florine; Aigner, Birgit (March 2017). "β-Defensin 2 is a responsive biomarker of IL-17A–driven skin pathology in patients...

Structural similarity of the light chain clip domain to horseshoe crab defensin suggests that the clip domain may have some antimicrobial activity. The...

Chertov O, Michiel DF, Xu L, et al. (1996). "Identification of defensin-1, defensin-2, and CAP37/azurocidin as T-cell chemoattractant proteins released...

(March 2002). "Antibacterial activities and conformations of bovine β-defensin BNBD-12 and analogs:structural and disulfide bridge requirements for activity"...

October 2013 El comissari de Venècia busca artistes “espectaculars” i que “defensin l’obra” Henry Périer, Chinese contemporary art in French curator's eyes...