Search Results: Defensins

Redirect to:

  • From the plural form: This is a redirect from a plural noun to its singular form.
    • This redirect link is used for convenience; it is often preferable to add the plural directly after the link (for example, [[link]]s). However, do not replace these redirected links with a simpler link unless the page is updated for another reason (see WP:NOTBROKEN).
    • Use this rcat to tag only mainspace redirects; when plural forms are found in other namespaces, use {{R from modification}} instead.


Defensin
Kamis, 2026-02-19 20:23:58

responsible for defensin production are highly polymorphic.[citation needed] Vertebrate defensins are primarily α-defensins and β-defensins. Some primates...

Click to read more »
Plant defensin
Kamis, 2025-11-06 23:29:14

Plant defensins (formerly gamma-thionins) are a family of primitive, highly stable, cysteine-rich defensins found in plants that function to defend them...

Click to read more »
Paneth cell
Rabu, 2026-04-08 04:09:24

functioning to protect. Human Paneth cells produce two α-defensins known as human α-defensin HD-5 (DEFA5) and HD-6 (DEFA6). HD-5 has a wide spectrum of...

Click to read more »
Platypus venom
Minggu, 2026-05-17 07:14:12

convergent evolution of venom genes from existing immune system genes (defensins). A unique feature of the venom is the presence of a D-amino acid. This...

Click to read more »
Theta defensin
Minggu, 2025-09-28 12:19:34

Theta-defensins (θ-defensins, retrocyclins, or demidefensins) are a family of mammalian antimicrobial peptides. They are found in non-human 'Old World'...

Click to read more »
Arthropod defensin
Rabu, 2026-04-29 22:52:16

Arthropod defensins are a family defensin proteins found in mollusks, insects, and arachnids. These cysteine-rich antibacterial peptides are primarily...

Click to read more »
Beta defensin 1
Minggu, 2025-09-28 12:16:26

Beta-defensin 1 is a protein that in humans is encoded by the DEFB1 gene. Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils...

Click to read more »
List of antimicrobial peptides in the female reproductive tract
Jumat, 2026-04-17 01:30:18

are part of the reproductive system in women. Defensins alpha-Defensins beta-Defensins theta-defensins Cathelicidins LL-37 Whey acid proteins SLPI Elafin...

Click to read more »
Alpha defensin
Kamis, 2026-02-19 20:21:02

Alpha defensins are a family of mammalian defensin peptides of the alpha subfamily. They are also known as cryptdins and are produced within the small...

Click to read more »
Beta-defensin 2
Minggu, 2025-09-28 12:12:49

for the discrepancy. Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar...

Click to read more »
DEFB105A
Minggu, 2025-09-28 12:13:01

neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: Alpha defensins, Beta defensins and Theta...

Click to read more »
Beta defensin
Minggu, 2025-09-28 12:16:43

Beta defensins are a family of vertebrate defensins. The beta defensins are antimicrobial peptides implicated in the resistance of epithelial surfaces...

Click to read more »
Antimicrobial peptides
Senin, 2026-03-23 10:58:24

family of plant defensins rupture membranes by identifying key phospholipids in the cell membranes of the pathogen. Human defensins have been thought...

Click to read more »
Immune system
Selasa, 2026-04-21 01:47:03

These mechanisms include phagocytosis, antimicrobial peptides called defensins, RNA interference, and the complement system. Jawed vertebrates, including...

Click to read more »
Brilacidin
Minggu, 2025-12-21 04:17:05

which are defensins, are part of the innate immune response and are common to most higher forms of life. As brilacidin is modeled after a defensin, it is...

Click to read more »
Monotreme
Senin, 2026-05-11 14:04:28

contains a powerful venom in the male platypus. This venom is derived from β-defensins, proteins that are present in mammals that create holes in viral and bacterial...

Click to read more »
Innate immune system
Senin, 2026-05-11 05:09:22

immunity. Several species of insect produce antimicrobial peptides known as defensins and cecropins. In invertebrates, PRRs trigger proteolytic cascades that...

Click to read more »
Azurophilic granule
Rabu, 2023-12-06 02:28:22

anti-microbial defensins that fuse with phagocytic vacuoles. Azurophils may contain myeloperoxidase, phospholipase A2, acid hydrolases, elastase, defensins, neutral...

Click to read more »
Neutrophil
Senin, 2026-03-23 01:20:31

Myeloperoxidase, bactericidal/permeability-increasing protein (BPI), defensins, and the serine proteases neutrophil elastase, Proteinase 3 and cathepsin...

Click to read more »
DEFA1
Minggu, 2025-09-28 12:17:14

encoded by the DEFA1 gene. Human alpha defensin 1 belongs to the alpha defensin family of antimicrobial peptides. Defensins are a family of microbicidal and...

Click to read more »
Virtual colony count
Kamis, 2026-05-28 03:52:39

using MHB are not applicable to antimicrobial agents such as defensins, because defensins must be incubated in a low salt buffer, not rich broth, in order...

Click to read more »
Intestinal mucosal barrier
Rabu, 2026-04-01 07:10:11

epithelial cells called Paneth cells secrete abundant quantities human α-defensins into the intestinal lumen of healthy individuals. Lysozyme is another...

Click to read more »
CSAB
Selasa, 2023-06-27 03:03:47

States CSαβ (Cysteine-stabilized alpha beta) defensins, a superfamily of proteins, also called cis-defensins This disambiguation page lists articles associated...

Click to read more »
Cathelicidin antimicrobial peptide
Sabtu, 2026-02-07 23:03:56

antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides...

Click to read more »
Roseomonas mucosa
Jumat, 2026-02-20 04:11:21

containing a strain of R. mucosa called RSM 2015 under the brand name Skinesa Defensin. Han XY, Pham AS, Tarrand JJ, Rolston KV, Helsel LO, Levett PN. Bacteriologic...

Click to read more »
Beta-defensin 3
Rabu, 2024-12-25 12:24:34

Beta-defensin 3 is a protein that in humans is encoded by the DEFB3 gene. HBD-3 was first isolated from human lesional psoriatic scales. RT-PCR showed...

Click to read more »
DEFA6
Minggu, 2025-09-28 12:19:21

gene. DEFA6 is expressed in the Paneth cells of the ileum. The alpha defensins are a family of microbicidal and cytotoxic peptides that defend the host...

Click to read more »
Pseudoplectania nigrella
Sabtu, 2025-07-12 18:24:26

defensins have commonalities in their molecular structure, such as cysteines in the peptide stabilized with disulfide bonds. In particular, defensins...

Click to read more »
DEFB106A
Minggu, 2025-09-28 12:15:54

neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins...

Click to read more »
Lung
Senin, 2026-05-04 04:44:27

secrete mucus which also contains several antimicrobial compounds such as defensins, antiproteases, and antioxidants. The size of the respiratory tract and...

Click to read more »
Platypus
Senin, 2026-05-25 03:11:47

pain) that can last as long as months. The venom is composed largely of defensin-like proteins (DLPs) produced by the immune system, some of which are unique...

Click to read more »
DEFA5
Minggu, 2025-09-28 12:20:39

the DEFA5 gene. DEFA5 is expressed in the Paneth cells of the ileum. Defensins are a family of microbicidal and cytotoxic peptides (antimicrobial peptides;...

Click to read more »
DEFA4
Minggu, 2025-09-28 12:19:07

bacteria and viruses. Defensins are a peptide family of cytotoxic microbicides involved in innate immunity. Members of the defensin family are distinguished...

Click to read more »
Venom
Rabu, 2026-05-20 19:29:25

Whittington, C. M.; Papenfuss, A. T.; Bansal, P.; et al. (June 2008). "Defensins and the convergent evolution of platypus and reptile venom genes". Genome...

Click to read more »
DEFB104A
Minggu, 2025-09-28 12:17:23

neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins...

Click to read more »
Ileum
Rabu, 2026-04-01 12:52:28

intestinal glands and release antimicrobial substances such as alpha defensins and lysozyme; microfold cells, which take up and transport antigens from...

Click to read more »
Wound licking
Rabu, 2026-04-29 01:38:20

extrinsic blood coagulation cascade. The enzymes lysozyme and peroxidase, defensins, cystatins and an antibody, IgA, are all antibacterial. Thrombospondin...

Click to read more »
Skin secretions
Senin, 2024-05-13 04:57:25

lubricates and waterproofs the outer layer of the skin, the stratum corneum. Defensins are substances that are secreted onto the skin surface that are anti-microbial...

Click to read more »
Labrador Retriever
Senin, 2026-05-18 19:34:37

CBD103 (KB) have a black coat resulting from the interaction between a β-defensin and MC1R (black Curly Coated Retriever, bottom)." — Candille, Kaelin, et...

Click to read more »
Respiratory system
Jumat, 2026-05-22 17:55:46

the lungs. These include secretory immunoglobulins (IgA), collectins, defensins and other peptides and proteases, reactive oxygen species, and reactive...

Click to read more »
Saliva
Senin, 2026-06-08 14:25:35

bacteria: Lysozyme Salivary lactoperoxidase Lactoferrin Immunoglobulin A Beta defensin Proline-rich proteins (function in enamel formation, Ca2+-binding, microbe...

Click to read more »
Granulocyte
Rabu, 2026-04-29 23:28:52

in more mature cells). Primary granules contain cationic proteins and defensins that are used to kill bacteria, proteolytic enzymes and cathepsin G to...

Click to read more »
DEFB129
Sabtu, 2025-07-19 12:35:20

Beta-defensin 129 is a protein that in humans is encoded by the DEFB129 gene. Defensins are cysteine-rich cationic polypeptides that are important in the...

Click to read more »
Thionin
Jumat, 2026-01-02 21:50:14

similar structure but are an unrelated class of protein, now called plant defensins. The proteins are toxic to animal cells, presumably attacking the cell...

Click to read more »
DEFA3
Sabtu, 2025-07-19 12:35:15

encoded by the DEFA3 gene. Human alpha defensin 3 belongs to the alpha defensin family of antimicrobial peptides. Defensins are a family of microbicidal and...

Click to read more »
Phagocytosis
Kamis, 2026-04-09 20:01:48

permeability-increasing protein, Major basic protein and cationic proteins such as defensins. Other antimicrobial peptides are present in these granules, including...

Click to read more »
Bacillus anthracis
Rabu, 2026-05-27 23:15:01

Polysaccharides are associated with adhesion of neutrophil-secreted defensins that inactivate and degrade the bacteria. By not containing this macromolecule...

Click to read more »
8p23.1 duplication syndrome
Rabu, 2026-05-20 02:55:12

S2CID 205309084. Hollox EJ, Barber JC, Brookes AJ, Armour JA (2008). "Defensins and the dynamic genome: what we can learn from structural variation at...

Click to read more »
HNP
Kamis, 2022-01-20 22:10:13

political alliance in the Philippines Human neutrophil peptides or alpha defensins 1-4 This disambiguation page lists articles associated with the title...

Click to read more »
Infant mortality
Senin, 2026-06-08 07:38:58

C-reactive protein, ferritin, various interleukins, chemokines, cytokines, defensins, and bacteria, have been shown to be associated with increased risks of...

Click to read more »
Mugwort
Jumat, 2026-05-08 03:16:23

the major allergen of mugwort pollen, is a modular glycoprotein with a defensin-like and a hydroxyproline-rich domain". The FASEB Journal. 17 (1): 106–8...

Click to read more »
DEFB119
Sabtu, 2026-05-16 16:15:02

PMC 122330. PMID 11854508. "Entrez Gene: DEFB119 defensin, beta 119". Lehrer RI, Ganz T (2002). "Defensins of vertebrate animals". Curr. Opin. Immunol. 14...

Click to read more »
Drosomycin
Sabtu, 2026-03-21 04:54:07

also found in Drosophila defensin, and some plant defensins. Drosomycin has greater sequence similarity with these plant defensins (up to 40%), than with...

Click to read more »
Wolfdog
Jumat, 2026-05-29 14:12:12

it was discovered that a gene mutation responsible for the protein beta-defensin 3 is responsible for the black coat color in dogs. The same mutation was...

Click to read more »
Natural killer cell
Minggu, 2026-06-07 22:40:04

virions, whereas apoptosis leads to destruction of the virus inside. α-defensins, antimicrobial molecules, are also secreted by NK cells, and directly...

Click to read more »
Earwax
Jumat, 2026-06-05 13:26:18

Moens U, McCray PB, Stenfors LE, Seljfelid R (September 1999). "Human beta-defensin-1 mRNA is transcribed in tympanic membrane and adjacent auditory canal...

Click to read more »
Catheter
Kamis, 2026-02-26 12:40:11

Claudio; Bruin, Gerard; Polus, Florine; Aigner, Birgit (March 2017). "β-Defensin 2 is a responsive biomarker of IL-17A–driven skin pathology in patients...

Click to read more »
Taste receptor
Sabtu, 2026-05-23 04:29:31

TAS2R fixed immune system. The innate immune system uses nitric oxide and defensins which are capable of destroying bacteria, and also viruses. These fixed...

Click to read more »
Black wolf
Sabtu, 2026-05-23 12:43:33

It was discovered that a gene mutation responsible for the protein beta-defensin 3, known as the K locus, is responsible for the black coat colour in dogs...

Click to read more »
Bile bear
Selasa, 2026-04-07 06:25:08

immunoregulatory responses by regulation of cytokines, antimicrobial peptides defensins, and take an active part in increased restitution of wound in the colon...

Click to read more »
Copsin
Rabu, 2025-10-29 08:07:06

for use in the food industry for food preservation. defensins plectasin, the first fungal defensin discovered 2005 Essig A, Hofmann D, Münch D, et al....

Click to read more »
Protegrin
Selasa, 2026-06-02 23:55:39

antimicrobial peptides, AMPs, that display limited sequence similarity to certain defensins and tachyplesins. In solution, the peptides fold to form an anti-parallel...

Click to read more »
Leukocyte esterase
Rabu, 2025-08-20 14:19:53

much less expensive than testing for alpha-defensin. Enzyme List of enzymes Ester Biomarker Alpha-defensin Kiss MO, Massé V (2023). "Biomarkers of periprosthetic...

Click to read more »
Peptide
Sabtu, 2026-05-30 22:09:29

signaling functions. Magainin family Cecropin family Cathelicidin family Defensin family Substance P Kassinin Neurokinin A Eledoisin Neurokinin B VIP (Vasoactive...

Click to read more »
Ornithodoros savignyi
Minggu, 2026-03-22 15:20:38

tachycardia. The defensins employed by O. savignyi are being studied for developing multifunctional peptides - shorter peptides derived from the defensin isoform...

Click to read more »
Ursodeoxycholic acid
Rabu, 2025-12-24 20:24:03

immunoregulatory responses by regulation of cytokines, antimicrobial peptides defensins, and take an active part in increased restitution of wound in the colon...

Click to read more »
Peripheral membrane protein
Jumat, 2026-05-08 08:19:06

LW, Yang D (November 2003). "Roles of antimicrobial peptides such as defensins in innate and adaptive immunity". Annals of the Rheumatic Diseases. 62...

Click to read more »
DEFB127
Sabtu, 2025-07-19 12:35:18

Beta-defensin 127 is a protein that in humans is encoded by the DEFB127 gene. Defensins are cysteine-rich cationic polypeptides that are important in the...

Click to read more »
Platelet
Senin, 2026-05-04 18:41:57

platelets release reactive oxygen species (ROS), antimicrobial peptides, defensins, kinocidins and proteases, killing the bacteria directly. Platelets also...

Click to read more »
Ocular immune system
Sabtu, 2025-03-08 17:27:41

epithelial cells) and tumor necrosis factor (TNF)-α to produce both IL-6 and defensins. Of these, the former is found to combine synergistically with other interleukins...

Click to read more »
Mesenchymal stem cell
Senin, 2026-05-11 13:48:50

antimicrobial peptides (AMPs), including human cathelicidin LL-37, β-defensins, lipocalin 2 and hepcidin. These peptides, together with the enzyme indoleamine...

Click to read more »
PRR23A
Minggu, 2026-02-08 01:29:14

USP17L7 Name Basis Function DEFB106A Beta-defensin 106A Textmining and Co-expression Belongs to the defensin family which are antimicrobial and cytotoxic...

Click to read more »
Cicindela littoralis
Kamis, 2026-05-28 04:48:59

Calomera species littoralis. Identification, structural characterisation and expression analysis of a defensin gene from the tiger beetle Calomera littoralis...

Click to read more »
CCR5
Sabtu, 2025-10-25 02:09:38

"Oral mucosal expression of HIV-1 receptors, co-receptors, and alpha-defensins: tableau of resistance or susceptibility to HIV infection?". Advances...

Click to read more »
Trefoil factor 3
Selasa, 2025-10-21 19:06:44

activated the epithelial cells in culture to produce beta-defensin 2 (hBD2) and beta defensins 4 (hBD4). These findings suggest that TFF can activate intestinal...

Click to read more »
Myotoxin
Senin, 2024-12-23 07:08:00

Ponting, CP; Temple-Smith, P; Warren, WC; Kuchel, PW; Belov, K (Jun 2008). "Defensins and the convergent evolution of platypus and reptile venom genes". Genome...

Click to read more »
Transforming growth factor beta
Senin, 2026-06-08 10:46:30

factor that regulates the production of cytokines like IL-1, TNF-a, and defensins, although its function in apoptosis may be separate from this function...

Click to read more »
Genetically modified organism
Kamis, 2026-05-28 17:58:18

In 2017, researchers genetically modified a virus to express spinach defensin proteins. The virus was injected into orange trees to combat citrus greening...

Click to read more »
DEFA1B
Kamis, 2025-07-17 23:17:51

Defensin, alpha 1B a human protein that is encoded by the DEFA1B gene. defensin ENSG00000285176 GRCh38: Ensembl release 89: ENSG00000240247, ENSG00000285176...

Click to read more »
Lipid II
Kamis, 2025-12-25 03:32:11

pyrophosphate. Lipid II interacts with human alpha defensins, a class of antimicrobial peptides, such as Defensin, alpha 1. The latter has been used to describe...

Click to read more »
Argopecten irradians
Senin, 2026-04-06 09:46:54

Song 2006 also found an inhibitor of κB (IκB). AiBD is the first big defensin cloned from this scallop. The gene is 531 nucleotides and the polypeptide...

Click to read more »
Perdita Barran
Sabtu, 2025-11-08 20:11:54

platform grant to study the structure-activity relationships of Beta defensins. She works with Cait MacPhee, Garth Cooper and Tilo Kunath on neurodegenerative...

Click to read more »
Beetin
Minggu, 2026-05-10 04:48:18

rRNA N-glycosidase activity. The carboxy-terminal amino acid sequence of defensins, which is distinguished by the presence of two antiparallel -strands with...

Click to read more »
Honey
Sabtu, 2026-06-06 09:34:16

use include methylglyoxal, hydrogen peroxide, and royalisin (also called defensin-1). For chronic and acute coughs, a Cochrane review found no strong evidence...

Click to read more »
Wolbachia
Kamis, 2026-06-04 23:54:31

pathway, which is essential for activation of antimicrobial peptides, defensins, and cecropins that help to inhibit virus proliferation. Conversely, certain...

Click to read more »
Vaginal epithelium
Senin, 2026-01-12 21:32:22

barrier to microbes by the synthesis of antimicrobial peptides (beta-defensins and cathelicidins) and immunoglobulins. Terminally differentiated, superficial...

Click to read more »
DEFB126
Kamis, 2025-07-17 23:17:57

Beta-defensin 126 is a protein that in humans is encoded by the DEFB126 gene. Defensins are cysteine-rich cationic polypeptides that are important in the...

Click to read more »
Ayyalusamy Ramamoorthy
Sabtu, 2026-05-16 00:14:30

(2006) 1408-1425. Dhople V, Krukemeyer A, Ramamoorthy A, The human beta-defensin-3, an antibacterial peptide with multiple biological functions, Biochim...

Click to read more »
DEFB118
Kamis, 2025-07-17 23:17:56

PMID 15033915. "Entrez Gene: DEFB118 defensin, beta 118". van Wetering S, Sterk PJ, Rabe KF, Hiemstra PS (Dec 1999). "Defensins: key players or bystanders in...

Click to read more »
HD5
Sabtu, 2022-08-06 10:38:43

star located at (J2000.0; 00h 05m 10.1829s; +02° 23′ 49.949″) Human Alpha Defensin 5, the DEFA5 gene product This disambiguation page lists articles associated...

Click to read more »
Murine respirovirus
Minggu, 2026-05-10 10:36:02

effective stimulant of expression of human beta-defensin-1 (hBD-1). This protein is a member of the beta-defensin family of proteins that bridges innate and...

Click to read more »
Protein superfamily
Selasa, 2026-02-10 12:41:54

Smith DG, Li Y, Yang M, Zhu Q (June 2014). "Evolution of primate α and θ defensins revealed by analysis of genomes". Molecular Biology Reports. 41 (6): 3859–66...

Click to read more »
Odontoblast process
Rabu, 2026-04-29 05:55:07

contents. Most common & well studied defensins synthesised by the odontoblast process are the human-ß defensins (hBDs) -1, -2, -3 and -4 which vary in...

Click to read more »
Melanocortin
Selasa, 2026-01-20 17:13:31

activity, agouti and agouti-related protein (AgRP). Lastly, the ligand β-defensin 3 acts as a neutral melanocortin receptor antagonist. The five melanocortin...

Click to read more »
Dog anatomy
Sabtu, 2026-05-02 21:18:12

project took samples from 38 different breeds to find the gene (a beta defensin gene) responsible for dog coat color. One version produces yellow dogs...

Click to read more »
Lysozyme
Kamis, 2026-04-30 20:59:07

the eye) is, instead, protected by secreted enzymes, mainly lysozyme and defensin. However, when these protective barriers fail, conjunctivitis results.[citation...

Click to read more »
Volatile organic compound
Sabtu, 2026-03-14 13:17:57

downregulate antimicrobial peptides on the skin like cathelicidin LL-37, human β-defensin 2 and 3. Xylene and formaldehyde worsen allergic inflammation in animal...

Click to read more »
Anti-inflammatory agents in breast milk
Rabu, 2026-02-04 02:53:19

toll-like receptors (TLRs) prevents pro-inflammatory cytokine expression beta defensins bioactive peptides recruit T cells and enhance TLRs chondroitin sulfate...

Click to read more »
Domestication of the dog
Jumat, 2026-05-15 19:36:25

European and Middle Eastern wolves showing contributions from dogs. The β-defensin gene responsible for the black coat of North American wolves was the result...

Click to read more »
Interleukin 22
Kamis, 2025-11-20 09:38:37

proliferation and synthesis of antimicrobials including S100, Reg3β, Reg3γ and defensins. It is also thought to play a role in regulating lipid metabolism, glucose...

Click to read more »
Pluripotency (biological compounds)
Kamis, 2025-11-06 03:01:01

cells do a variety of tasks including recruiting neutrophils, creating defensins, and mediating inflammation in the intestinal epithelium and skin. TH2...

Click to read more »
Heteroscorpine
Sabtu, 2025-06-14 04:23:57

has a cytolytic and/or antimicrobial activity similar to that of insect defensins), and a C-terminal region with a CSαβ motif, which causes potassium channel-blocking...

Click to read more »
Bombus ignitus
Rabu, 2025-10-15 14:13:52

four antibacterial peptide genes - apidaecin, hymenoptaecin, abaecin, and defensin - were isolated and cloned from B. ignitus. Synthesized abaecin has been...

Click to read more »
Snake venom
Rabu, 2026-06-03 23:24:56

Papenfuss AT, Bansal P, Torres AM, Wong ES, Deakin JE, et al. (June 2008). "Defensins and the convergent evolution of platypus and reptile venom genes". Genome...

Click to read more »
Pulp (tooth)
Sabtu, 2026-03-28 19:26:01

chemokines. One important antimicrobial agent produced by odontoblasts is beta-defensins (BDs). BDs kill microorganisms by forming micropores that destroy membrane...

Click to read more »
Damage-associated molecular pattern
Kamis, 2025-10-09 16:55:55

peptide FPR1 mROS NLRP3 Endoplasmic reticulum Calreticulin CD91 Granule Defensins TLR4 Cathelicidin (LL37) P2X7, FPR2 Eosinophil-derived neurotoxin TLR2...

Click to read more »
Guavanin 2
Senin, 2026-03-30 10:51:46

of the innate immune system of countless organisms. Plant AMPs such as defensins, thionins, and cyclotides have been investigated as alternatives to conventional...

Click to read more »
Labrador Retriever coat colour genetics
Rabu, 2025-09-10 15:55:45

repressor that is a product of the Agouti gene (A locus), and an activator, β-Defensin 103 (CBD103), recently named the K locus. In Labradors a highly-active...

Click to read more »
FCGR3B
Kamis, 2025-07-17 00:18:40

Kimberly RP (Dec 2003). "Fc gamma RIIIb allele-sensitive release of alpha-defensins: anti-neutrophil cytoplasmic antibody-induced release of chemotaxins"...

Click to read more »
Plectasin
Minggu, 2025-09-28 12:14:24

Novozymes. Plectasin belongs to the antimicrobial peptide class called fungal defensins, which is also present in invertebrates such as flies and mussels.[citation...

Click to read more »
Granule (cell biology)
Minggu, 2026-02-15 06:43:42

hydrolytic enzymes including elastase, myeloperoxidase, cathepsins, and defensins that aid in pathogen destruction. Secondary granules, or specific granules...

Click to read more »
Keratinocyte
Selasa, 2025-12-23 20:06:45

keratin), enzymes (e.g. proteases), lipids, and antimicrobial peptides (defensins) contribute to maintain the important barrier function of the skin. Keratinization...

Click to read more »
Phoneutria pertyi
Selasa, 2024-10-22 15:55:32

putative cysteines, other putative components of the venom such as protease, defensins and serine proteases were identified, glycine-rich proteins (GRP) were...

Click to read more »
LmαTX3
Kamis, 2026-04-30 00:43:36

PMC 3091649. PMID 20663230. Mngyue, Lv (2016). "A Family of CSαβ Defensins and Defensin-Like Peptides from the Migratory Locust, Locusta migratoria, and...

Click to read more »
Zizania latifolia
Selasa, 2026-01-20 14:01:20

Ustilago esculenta stimulates innate immune system, via induction of human β-defensin-2. Archived 1 June 2018 at the Wayback Machine ISHS Acta Horticulturae...

Click to read more »
Microbial symbiosis and immunity
Selasa, 2025-09-23 21:44:26

secretes a small molecule AMP which leads to increased expression of Human β-defensins. S. epidermidis also stimulates IL-17A+ CD8+ T cells production that increases...

Click to read more »
Epsilon cell
Rabu, 2026-03-11 00:29:12

family member 1 (ACSL1) and defensin beta 1. ACSL1 is thought to play a role in the processing of ghrelin while defensin beta 1 produces a protein that...

Click to read more »
TEDDM1
Kamis, 2025-12-18 05:18:31

fiber protein 3-like protein 1 Active in cytoskeleton DEFB30 Beta-defensin 130a; Defensin, beta 130 Antimicrobial host-defense peptide, antiplasmodial activity...

Click to read more »
Mesosome
Senin, 2026-04-13 13:59:29

been exposed to some classes of antibiotics, and antibacterial peptides (defensins). The appearance of these mesosome-like structures may be the result of...

Click to read more »
Soy allergy
Kamis, 2026-05-28 11:46:48

Proteins numbered by IUIS include: Gly m 1, a hydrophobic protein Gly m 2, defensin Gly m 3, profilin Gly m 4, PR-10 Gly m 5, vicilin, a cupin Gly m 6, legumin...

Click to read more »
Chromosome 20
Minggu, 2025-09-21 21:14:56

DEAD box polypeptide 27 DEFB118, DEFB119, DEFB126, DEFB127, DEFB129: Beta-defensin genes DLGAP4: Disks large-associated protein 4 DNAJC5: Cysteine string...

Click to read more »
Interleukin-17 receptor
Selasa, 2025-01-21 12:10:20

drive infiltration of macrophages and antimicrobial products, for example defensins and mucins. All these products contribute to the development of inflammation...

Click to read more »
Nanonet
Jumat, 2023-10-27 09:23:22

carbon, metals, silicon, or peptides, such as nanonets composed of the defensin HD6. The word nanonet is also used in reference to a nanoscale communication...

Click to read more »
Interleukin
Minggu, 2026-05-17 23:53:13

differentiation of Th17 cells IL-22 T helper 17 cells (Th17) IL22R Production of defensins from epithelial cells. Activates STAT1 and STAT3 and increases production...

Click to read more »
Legionella dumoffii
Sabtu, 2025-08-16 04:46:03

Cytryńska, M (2012). "Anti-Legionella dumoffii activity of Galleria mellonella defensin and apolipophorin III". Int J Mol Sci. 13 (12): 17048–64. doi:10.3390/ijms131217048...

Click to read more »
Protease-activated receptor
Selasa, 2025-11-25 18:44:07

inducing the production of peptides related to innate defense, such as defensins and cytokines. PARs are activated by the action of serine proteases such...

Click to read more »
Peptidoglycan recognition protein 4
Rabu, 2026-05-27 08:10:58

does not involve cell membrane permeabilization, which is typical for defensins and other antimicrobial peptides, cell wall hydrolysis, or osmotic shock...

Click to read more »
Diffuse panbronchiolitis
Minggu, 2025-09-28 02:11:54

the chemokine MIP-1alpha and its involvement with CD8+ T cells. Beta defensins, a family of antimicrobial peptides found in the respiratory tract, are...

Click to read more »
Sulcular epithelium
Senin, 2026-03-30 10:54:40

retard the growth of bacteria.This is through the secretion of defensins (β-defensins (hBD-1 and hBD-2)) which are a unique feature of the sulcular epithelium...

Click to read more »
Lingual antimicrobial peptide
Kamis, 2025-10-16 14:29:13

antimicrobial activities, and primary structures of hamster neutrophil defensins". Infection and Immunity. 64 (11): 4444–9. doi:10.1128/IAI.64.11.4444-4449...

Click to read more »
Robert G. Hale
Minggu, 2026-05-10 00:45:24

contains a synthetic sequence of anti-microbial peptides which mimic defensins (the bacteria-killing molecules naturally found in saliva. Though this...

Click to read more »
APETx1
Senin, 2025-07-07 01:55:43

Through its folding pattern, APETx1 is classified as a member of the Defensin family. APETx1 has an 88% homology with APETx4, another Anthopleura elegantissima...

Click to read more »
Promiscuous gene expression
Kamis, 2025-10-09 15:51:14

antigens are represented for example by insulin from the pancreas or defensins from the gastrointestinal tract. Antigen-presenting cells (APCs) of the...

Click to read more »
Peptidoglycan recognition protein 1
Rabu, 2026-05-27 08:10:53

does not involve cell membrane permeabilization, which is typical for defensins and other antimicrobial peptides, cell wall hydrolysis, or osmotic shock...

Click to read more »
PRR23C
Kamis, 2025-10-30 23:22:00

Macaques Supports an Adaptive Role for Copy Number Variation of the b-Defensin-2 Gene". Genome Biology and Evolution. 6 (11): 3025–3038. doi:10.1093/gbe/evu236...

Click to read more »
Genetically modified virus
Sabtu, 2026-03-07 08:45:34

infection. Since 2009 genetically modified viruses expressing spinach defensin proteins have been field trialed in Florida (USA). The virus infection...

Click to read more »
Perforin-1
Jumat, 2025-10-03 04:17:30

progression. Perforin has been shown to interact with calreticulin. Granzymes Defensin Complement membrane attack complex GRCh38: Ensembl release 89: ENSG00000180644...

Click to read more »
Intestinal epithelium
Rabu, 2026-05-06 21:54:48

cells. Paneth cells produce antimicrobial peptides such as human alpha-defensin. Microfold cells (commonly referred to as M cells) sample antigens from...

Click to read more »
Cm28
Kamis, 2025-10-16 01:38:59

is a specific quality of the proteins from the mentioned family. Both defensins and venom toxins, like Cm28, share a structural similarity. Both are cysteine-rich...

Click to read more »
Burkholderia mallei
Selasa, 2026-03-24 00:39:19

cell early also keeps the bacteria from being destroyed by lysosomal defensins and other pathogen-killing agents. MNGCs may help protect the bacteria...

Click to read more »
MTA2
Jumat, 2025-11-14 00:15:27

MTA2 is inhibited by the Rho GDIa in breast cancer cells and by human β-defensins in colon cancer cells. MicroRNAs-146a and miR-34a also regulate the levels...

Click to read more »
Peptidoglycan recognition protein 3
Rabu, 2026-04-08 01:11:22

does not involve cell membrane permeabilization, which is typical for defensins and other antimicrobial peptides, cell wall hydrolysis, or osmotic shock...

Click to read more »
ELF4
Kamis, 2025-07-17 00:12:57

Suico MA, Shuto T, Li JD, Kai H (March 2004). "MEF up-regulates human beta-defensin 2 expression in epithelial cells". FEBS Letters. 561 (1–3): 117–21. Bibcode:2004FEBSL...

Click to read more »
Cysteine-rich protein
Senin, 2025-10-06 02:14:24

development, and seed development. Many CRPs function in plant defense. Defensins, a major class of CRP with an eight-cysteine motif forming four disulfide...

Click to read more »
Canine terminology
Rabu, 2026-05-27 11:01:05

project took samples from 38 different breeds to find the gene (a beta defensin gene) responsible for dog coat color. One version produces yellow dogs...

Click to read more »
Tachystatin
Kamis, 2020-12-24 07:28:53

Tachystatin A is thought to have an antimicrobial activity similar to defensins. Fujitani N, Kawabata S, Osaki T, Kumaki Y, Demura M, Nitta K, Kawano...

Click to read more »
Crotamine
Minggu, 2026-04-19 13:12:44

Crotamine is homologous with other venom myotoxins and is similar to α-,β-defensins. The amino acid sequence (YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG,...

Click to read more »
Systemin
Kamis, 2024-01-04 13:47:55

inhibitors which protect against insect herbivores, other peptides activate defensins and modify root growth. They have also been shown to affect plants' responses...

Click to read more »
Jules A. Hoffmann
Kamis, 2026-04-16 14:28:11

glycine-rich, along with other polypeptides in Drosophila melanogaster such as Defensin, Cecropin, and Attacin. Further molecular genetic analysis revealed that...

Click to read more »
Neutrophil-specific granule deficiency
Selasa, 2026-04-07 05:15:36

will be largely absent in the granulocytes of these patients, along with defensins (despite these also being found in azurophilic (primary) granules). The...

Click to read more »
Peptidoglycan recognition protein
Senin, 2026-03-30 12:12:23

porcine peptidoglycan recognition protein long isoforms: involvement in beta-defensin-1 expression". Infection and Immunity. 73 (11): 7133–7141. doi:10.1128/IAI...

Click to read more »
CCL20
Kamis, 2025-12-04 06:03:21

S2CID 14563599. Yang D, Chertov O, Bykovskaia SN, et al. (1999). "Beta-defensins: linking innate and adaptive immunity through dendritic and T cell CCR6"...

Click to read more »
Outline of immunology
Rabu, 2025-10-22 17:44:19

skin, tears, mucus, saliva, Gastric acid, etc.) Antimicrobial peptides Defensins Lysozyme Inflammation Inflammatory reflex Inflammasome Granuloma Acute-phase...

Click to read more »
DEFB103A
Kamis, 2025-07-17 00:05:41

Beta-defensin 103 is a protein that in humans is encoded by the DEFB103A gene. Defensins form a family of microbicidal and cytotoxic peptides made by...

Click to read more »
Buruli ulcer
Kamis, 2026-01-15 05:06:35

region that included a long non-coding RNA and was near the genes for beta-defensins, which are antimicrobial peptides involved in immunity and wound healing...

Click to read more »
Agrimonia procera
Jumat, 2025-12-26 16:09:16

"Agrimonia procera exerts antimicrobial effects, modulates the expression of defensins and cytokines in colonocytes and increases the immune response in...

Click to read more »
Dog coat genetics
Jumat, 2026-02-06 23:11:48

presence of other A-series alleles. The alleles at the K locus (the β-Defensin 103 gene or DEFB103) determine the coloring pattern of an animal's coat...

Click to read more »
Type 3 innate lymphoid cells
Jumat, 2025-10-10 05:26:51

as β-defensins, is a powerful mechanism that helps maintain intestinal homeostasis. An increase in IL-22 levels together with increased β-defensin expression...

Click to read more »
C-C chemokine receptor type 6
Kamis, 2025-12-04 06:46:52

Bykovskaia SN, Chen Q, Buffo MJ, Shogan J, et al. (October 1999). "Beta-defensins: linking innate and adaptive immunity through dendritic and T cell CCR6"...

Click to read more »
Genome evolution
Sabtu, 2026-04-11 07:41:42

PMID 15313546. Froy O, Gurevitz M (December 2003). "Arthropod and mollusk defensins--evolution by exon-shuffling". Trends in Genetics. 19 (12): 684–7. doi:10...

Click to read more »
Antimicrobial polymer
Jumat, 2026-05-15 12:33:35

including ampicillin, rifampin, cefotaxime, as well as others. Magainin and defensin are natural peptides, short polymers composed of amino acids, which display...

Click to read more »
Digital polymerase chain reaction
Jumat, 2026-05-15 02:18:05

accuracy in copy number variation: failure to replicate associations of beta-defensin copy number with Crohn's disease". Human Molecular Genetics. 19 (24): 4930–4938...

Click to read more »
Medical terminology
Kamis, 2026-04-30 13:23:25

The innate immune system, which provides a preconfigured response (e.g. defensins, complement system) to broad groups of situations and stimuli; and the...

Click to read more »
Kynurenine
Kamis, 2026-03-12 04:56:20

Michelle K.; Zhu, Hongjie; Jenkins, Gregory D. (January 10, 2018). "Beta-defensin 1, aryl hydrocarbon receptor and plasma kynurenine in major depressive...

Click to read more »
List of A1 genes, proteins or receptors
Selasa, 2022-03-15 01:06:59

nucleotide-gated channel alpha 1 Cyclin A1 Cytochrome P450, family 1, member A1 Defensin, alpha 1 Dystrophin-associated protein A1 Ephrin A1 Eukaryotic translation...

Click to read more »
Plant disease resistance
Kamis, 2026-06-04 11:28:22

phytoalexins such as genistein or camalexin Antimicrobial proteins such as defensins, thionins, or PR-1 Antimicrobial enzymes such as chitinases, beta-glucanases...

Click to read more »
MMP7
Sabtu, 2025-12-06 08:59:31

healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa. MMP7 was initially characterized by Woessner et...

Click to read more »
Agitoxin
Selasa, 2026-05-05 20:31:19

structure of charybdotoxin: common motifs in scorpion toxins and insect defensins". Science. 254 (5037): 1521–3. Bibcode:1991Sci...254.1521B. doi:10.1126/science...

Click to read more »
SPACA3
Kamis, 2025-07-17 01:39:37

infection: implication of naturally occurring human antimicrobial agents beta-defensins, cathelicidin LL-37 and lysozyme". J. Dermatol. Sci. 40 (3): 157–68. doi:10...

Click to read more »
C14orf80
Selasa, 2025-10-14 23:26:29

doi:10.1016/j.cell.2014.05.039. PMC 4104544. PMID 25036637. DEF107A Beta-defensin 107 Anti-bacterial activity XAGE1D Cancer/testis antigen family 12 member...

Click to read more »
Brassinolide
Rabu, 2025-09-24 07:32:48

expression of PDF1.2a and PDF1.2b to reduce that of antimicrobial protein defensins. Furthermore, BES1 interacts with the transcription factors MYBs and reduces...

Click to read more »
Jean-Pierre Lecocq
Minggu, 2026-06-07 09:17:37

Hoffmann and T. Achstetter Expression and Secretion in Yeast of Active Insect Defensin, an Inducible Antibacterial Peptide from the Fleshfly Phormia terranovae...

Click to read more »
Dental laser
Selasa, 2026-06-02 01:32:16

of 635 nm and 405 nm, and by increasing TGF-β1 signaling and Human Beta Defensin-2 (HBD-2) expression. These effects promote soft tissue regeneration and...

Click to read more »
Rorippa
Senin, 2026-01-26 10:11:22

Ranjan (2017-08-02). "Overexpression of biologically safe Rorippa indica defensin enhances aphid tolerance in Brassica juncea". Planta. 246 (5): 1029–1044...

Click to read more »
Wall-associated kinase
Senin, 2025-11-03 03:25:24

synthesis such as pectin esterase, leucine-rich transmembrane kinase, plant defensin. The remainder of the downregulated genes comprised those involved in multiple...

Click to read more »
Nutritional immunology
Rabu, 2026-03-25 22:17:22

Cammarota M, Alfano A, Schiraldi C, Donnarumma G (2017). "Beta-Defensin-2 and Beta-Defensin-3 Reduce Intestinal Damage Caused by Salmonella typhimurium Modulating...

Click to read more »
Venomics
Kamis, 2026-05-07 02:29:00

genes recruited from other tissue groups (Acetylcholinesterase, crotasin, defensin & cystatin). Due to this extraordinary amount of variation in the components...

Click to read more »
Pathogenesis-related protein
Kamis, 2025-10-16 10:10:50

chitinase V (Q43576) Chitinase PR-12 IPR008176 Radish Rs-AFP3 (O24332) Plant Defensin PR-13 IPR001010 Arabidopsis THI2.1 (Q42596) Thionin PR-14 IPR000528 Lipid...

Click to read more »
List of MeSH codes (D12.644)
Sabtu, 2025-07-19 13:22:14

NLM. MeSH D12.644.050.200 – defensins MeSH D12.644.050.200.050 – alpha defensins MeSH D12.644.050.200.075 – beta defensins MeSH D12.644.120.700 – sincalide...

Click to read more »
Dickeya dadantii
Rabu, 2026-06-03 21:52:36

Transfer of sweet pepper genes coding for ferredoxin like protein and defensin was shown to reduce D. dadantii disease in Phalaenopsis orchids under cultivation...

Click to read more »
Interleukin 17F
Selasa, 2025-03-11 10:33:43

resist bacteria. IL-17F has the ability to stimulate the production of defensins and other antimicrobial peptides; it can also resist bacteria through...

Click to read more »
Symbiosome
Selasa, 2026-05-12 10:47:06

(NCR peptides). NCRs are antimicrobial peptides that are similar to the defensin peptides used in mammals in response to invading pathogens. The NCRs are...

Click to read more »
Airway basal cell
Kamis, 2026-03-12 01:00:33

highly expressed in basal cells. Other innate immune mediators include beta-defensin 2, and lipocalin-2; pro-inflammatory cytokines, interleukins IL6, and IL8;...

Click to read more »
Sperm-associated antigen 11B
Rabu, 2025-07-16 05:20:21

of similarity to beta-defensins, a family of antimicrobial peptides. The gene is located on chromosome 8p23 near the defensin gene cluster. Alternative...

Click to read more »
Abzyme
Kamis, 2025-08-07 12:22:06

PAR-2 receptors, of intestinal epithelial cells HT-29, and promotes beta-defensin-2 expression. Immunology letters, 123(1), 52-59. Agarwal PK (2005). "Role...

Click to read more »
Imd pathway
Senin, 2026-01-12 21:18:58

Drosophila, particularly: Diptericin, Attacin, Drosocin, Cecropin, and Defensin. The Imd pathway regulates hundreds of genes after infection, however the...

Click to read more »
Complex lasso proteins
Rabu, 2025-12-17 15:55:59

lasso proteins may also be functional. This concerns toxic, antimicrobial, defensin-like or immune system related with L1 motif The current list of experimentally...

Click to read more »
Ustilago esculenta
Kamis, 2026-05-21 15:27:49

Ustilago esculenta stimulates innate immune system, via induction of human β-defensin-2. ISHS Acta Horticulturae 841: II International Symposium on Human Health...

Click to read more »
Index of immunology articles
Senin, 2024-01-15 08:24:31

Cytokine Cytokine redundancy Cytokine storm Cytotoxicity DAMPs Danger model Defensin Degranulation Dendritic cell Dextran 1 Dispanin Dog leukocyte antigen Drug...

Click to read more »
Protophormia terraenovae
Senin, 2026-05-18 22:15:12

immunity: expression of the two major inducible antibacterial peptides, defensin and diptericin, in Phormia terranovae." EMBO J. 9: 2507-515. Green, A....

Click to read more »
Leucine-rich repeat receptor like protein kinase
Senin, 2026-05-25 05:22:01

jasmonate/ethylene and salicylate defense hormones and induce the expression of PDF1.2 (defensin) gene being component of plant innate immune system. Expression of these...

Click to read more »
Peptidoglycan recognition protein 2
Rabu, 2025-10-22 02:55:02

porcine peptidoglycan recognition protein long isoforms: involvement in beta-defensin-1 expression". Infection and Immunity. 73 (11): 7133–41. doi:10.1128/IAI...

Click to read more »
GEFT
Kamis, 2026-05-14 03:00:41

(November 2004). "Structure-activity relationships in defensin dimers: a novel link between beta-defensin tertiary structure and antimicrobial activity". The...

Click to read more »
Open flow microperfusion
Jumat, 2026-05-08 08:06:54

Frank; Pieber, Thomas Rudolf; Patel, Dhavalkumar D. (March 2017). "β-Defensin 2 is a responsive biomarker of IL-17A–driven skin pathology in patients...

Click to read more »
Lajos Kemény
Minggu, 2026-04-19 19:06:04

the expression of pro-inflammatory cytokines, chemokines and human beta-defensin-2 in vaginal epithelial cells, MICROBES AND INFECTION 7: (9-10) pp. 1117–1127...

Click to read more »
Anticancer gene
Sabtu, 2026-05-30 17:22:33

known as Pelophylax porosus) was used to isolate the unique non-hemolytic defensin known as brevinin-2R. Malignant cells such as T-cell leukemia Jurkat, B-cell...

Click to read more »
Microdialysis
Kamis, 2025-08-14 20:33:24

Claudio; Bruin, Gerard; Polus, Florine; Aigner, Birgit (March 2017). "β-Defensin 2 is a responsive biomarker of IL-17A–driven skin pathology in patients...

Click to read more »
Limulus clotting enzyme
Kamis, 2026-02-19 19:00:32

Structural similarity of the light chain clip domain to horseshoe crab defensin suggests that the clip domain may have some antimicrobial activity. The...

Click to read more »
Azurocidin 1
Rabu, 2025-10-22 01:26:41

Chertov O, Michiel DF, Xu L, et al. (1996). "Identification of defensin-1, defensin-2, and CAP37/azurocidin as T-cell chemoattractant proteins released...

Click to read more »
Ramakrishnan Nagaraj
Selasa, 2026-02-10 09:53:42

(March 2002). "Antibacterial activities and conformations of bovine β-defensin BNBD-12 and analogs:structural and disulfide bridge requirements for activity"...

Click to read more »
Henry Périer
Rabu, 2022-06-01 07:25:13

October 2013 El comissari de Venècia busca artistes “espectaculars” i que “defensin l’obra” Henry Périer, Chinese contemporary art in French curator's eyes...

Click to read more »