DOKUMEN123.COM

genus Elephas is E. nawataensis from the Late Miocene-Early Pliocene of Kenya, though the validity of this species and its relationship to Elephas has been...

The Asian elephant (Elephas maximus), also known as the Asiatic elephant, is the only living species in the genus Elephas. It is the largest living land...

1017/S0025315400007700. S2CID 85220945. Crustaceans portal Media related to Palinurus elephas at Wikimedia Commons Photos of Palinurus elephas in the Sealife Collection...

elephant (Elephas maximus indicus) is one of three extant recognized subspecies of the Asian elephant. Carl Linnaeus proposed the scientific name Elephas maximus...

elephant or the Borneo pygmy elephant, is a subspecies of Asian elephant (Elephas maximus) that inhabits northeastern Borneo, in Indonesia and Malaysia....

mammoth its scientific name, Elephas primigenius, in 1799, placing it in the same genus as the Asian elephant (Elephas maximus). This name is Latin for...

suggested that Elephas recki should instead be placed in Palaeoloxodon, though many later authors continued to place the species in the genus Elephas, treating...

derived from the Latin word elephas (genitive elephantis) 'elephant', which is the Latinised form of the ancient Greek ἐλέφας (elephas) (genitive ἐλέφαντος (elephantos...

multiple taxonomists. Scottish writer Robert Kerr erected the species name Elephas americanus in 1792 based on fossil tusks and "grinders" from the Big Bone...

history museums from various parts of Africa, including: Elephas (Loxodonta) oxyotis and Elephas (Loxodonta) knochenhaueri by Paul Matschie in 1900. The...

given the subspecies designation Elephas maximus asurus) was the westernmost population of the Asian elephant (Elephas maximus), which went extinct in...

isodus, by Italian zoologist Saverio Macri (1754–1848) in 1819; Squalus elephas, by Charles Alexandre Lesueur in 1822; Squalus rashleighanus, by Jonathan...

America, and in South American rainforests. Megasoma elephas elephas (Fabricius, 1775) Megasoma elephas iijimai Nagai, 2003 Elephant beetle larvae develop...

Company in India at least as early as the 1830s. The species was named as Elephas namadicus by British paleontologists Hugh Falconer and Proby Cautley in...

Curculio elephas is a species of beetle in the family Curculionidae, the true weevils. It is known commonly as the chestnut weevil. It is a serious pest...

The Sumatran elephant (Elephas maximus sumatranus) is one of three recognized subspecies of the Asian elephant, and native to the Indonesian island of...

The Sri Lankan elephant (Elephas maximus maximus) is native to Sri Lanka and one of three recognised subspecies of the Asian elephant. It is the type...

proboscidean mammals which includes the living elephants (belonging to the genera Elephas and Loxodonta), as well as a number of extinct genera like Mammuthus (mammoths)...

scientific name, Elephas primigenius, in 1799, placing it in the Elephas, the genus which today contains the Asian elephant (Elephas maximus). Originally...

referred the species to Elephas. A paper by Paul Yves Sondaar in 1984 started a trend of referring to the two species to the genus "Elephas" with quotation remarks...

in 1857 by the Scottish naturalist Hugh Falconer, who named the species Elephas columbi after the explorer Christopher Columbus. The animal was brought...

to an elephant's head; Elephas is the Latin word for elephant. List of peaks on the British Columbia–Alberta border "Elephas Mountain". Bivouac.com....

ascribed by Falconer (for whom the species is named) to Elephas melitensis. The species Elephas/Palaeoloxodon melitensis, formerly considered a distinct...

Palaeoloxodon back into Elephas (which contains the living Asian elephant). While the sinking of Palaeoloxodon into Elephas (with Palaeoloxodon sometimes...

considered Palaeoloxodon a valid genus or a subgenus of Elephas. Cladistic analyses finding Elephas and Palaeoloxodon to not be each other's closest relatives...

Elephas hysudrindicus, commonly known also as the Blora elephant in Indonesia (lit. Gajah Blora in Indonesian), is a species of extinct elephant from...

of the genus Elephas, but should instead be considered a member of the genus Phanagoroloxodon with the African Pliocene species "Elephas" recki brumpti...

genus Elephas. It has been suggested to have been a grazer or mixed feeder (both browsing and grazing). Its placement in the genus of Elephas has been...

islands of the Mediterranean. Elephas celebensis of Sulawesi is believed to have descended from Elephas planifrons. Elephas falconeri of Malta and Sicily...

Elephas beyeri is an extinct species of elephantid known from the Middle Pleistocene of the Philippines. It was named after the anthropologist H. Otley...

Elephas platycephalus is an extinct species of large herbivorous mammals that were closely related to Asian elephants. It lived between 130,000 and 700...

1797 by Johann Friedrich Blumenbach, who proposed the scientific name Elephas africanus. Loxodonte was proposed as a generic name for the African elephant...

thought to belong to an extinct subspecies of the Asian elephant named Elephas maximus rubridens, they lived in Central and Southern China before the...

jolensis. While originally placed in Elephas, it is now placed in Palaeoloxodon. Some authors continue to use the genus Elephas. Todd, Nancy E. (2010). "New Phylogenetic...

Compsolechia elephas is a moth of the family Gelechiidae. It was described by Thomas de Grey, 6th Baron Walsingham, in 1910. It is found in Mexico (Guerrero)...

common rhinoceros beetle (Xylotrupes ulysses), elephant beetle (Megasoma elephas), European rhinoceros beetle (Oryctes nasicornis), Hercules beetle (Dynastes...

as opposed to (all) being extinct. For example: The Indian elephant (Elephas maximus) is an extant species, and the woolly mammoth (Mammuthus primigenius)...

Elephas hysudricus is an extinct elephant species known from the Pleistocene of Asia. It is thought to be ancestral to the living Asian elephant, from...

de Silva, S.; Kumar, A.; Baskaran, N.; Yoganand, K.; Menon, V. (2020). "Elephas maximus". IUCN Red List of Threatened Species. 2020 e.T7140A45818198. doi:10...

5 short tons). S. orientalis was around the size of an Asian elephant (Elephas maximus). Similar to modern-day elephants, stegodonts were likely good...

unidentified subspecies, and designated the fossil Elephas namadicus naumannni. Tadao Kamei identified Elephas namadicus naumanni as a new species, called Palaeoloxodon...

Symeonides, N.K.; G.E. Theodorou; V.I. Giannopoulos (2001). "New data on Elephas chaniensis (Vamos cave, Chania, Crete)". The World of Elephants - International...

Cora elephas, the elephant heart lichen, is a species of basidiolichen in the family Hygrophoraceae. It was formally described as a new species in 2016...

elephant Sumatran elephant Syrian elephant Elephas hysudrindicus Shoshani, J. (2005). "Subspecies Elephas maximus indicus". In Wilson, D.E.; Reeder, D...

Phanagoroloxodon resembles Elephas (which contains the living Asian elephant) and mammoths (genus Mammuthus) in many regards. Like Elephas, the top of the skull...

(Hors Série 5): 1–72. "Calliotropis elephas". Gastropods.com. Retrieved 15 January 2019. Media related to Calliotropis elephas at Wikimedia Commons v t e...

species was originally described as Elephas creticus by Dorothea Bate in 1907, who noted its similarity to Elephas meridionalis (now Mammuthus meridionalis)...

Brachylepis elephas is a species of beetle of the family Scarabaeidae. It is found in Kenya, the Democratic Republic of the Congo and Tanzania. Adults...

Strigocossus elephas is a moth in the family Cossidae. It is found in Malawi, South Africa (KwaZulu-Natal), Eswatini and Uganda. Natural History Museum...

keu) 체크메이트 (che keu me i teu) Latin R rex king D domina queen T turris / elephas tower / elephant S signifer / cursor / stultus / alphinus standard-bearer...

common ancestor of Mammuthus, the mammoths, and the closely allied genera Elephas and Loxodonta, the Asian and African elephants, diverging some 4-6 million...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Proceedings of the Royal Society in 1903 by Bate, when the species was named as Elephas cypriotes, with additional description of the remains in a later paper...

including Nepal's commitments under the CITES. In Nepal, the Asian elephant (Elephas maximus) is legally protected under the National Parks and Wildlife Conservation...

included sometimes in Elephas). The remains from Guardia Pisano Hill were initially attributed by Luigi Acconci in 1881 to Elephas melitensis. The first...

Wikimedia Commons has media related to Campylomormyrus elephas. Moelants, T. (2010). "Campylomormyrus elephas". IUCN Red List of Threatened Species. 2010 e.T181787A7734529...

elephants in the Peppara forest range, one the common Indian elephants (Elephas maximus indicus), and the other a dwarf variety which they call kallana...

female student of the Mische Academy. She develops feelings for Isaac. Elephas Levi (エレファス・レヴィ, Erefasu Revi) Voiced by: Koki Uchiyama A mage and member...

as a species of Elephas (which contains the living Asian elephant). Some specimens from this sample may genuinely represent Elephas rather than Mammuthus...

LEGS, SPINE AND TRACKS with literature reports for the Asian Elephant - Elephas maximus (editorial comment)". wildlifeinformation.org. Archived from the...

the crane genus Grus. On Sicily, its remains are associated with the "Elephas mnaidriensis" faunal complex, including carnivores like cave hyenas, cave...

Portuguese: Salomão) (c. 1540 – 18 December 1553) was an Asian elephant (Elephas maximus maximus) that was presented to the Habsburg Archduke Maximilian...

A phyllosoma larva of the spiny lobster Palinurus elephas, from Ernst Haeckel's Kunstformen der Natur...

lamarmorae (Major, 1883) Elephas antiquus (Acconci, 1881) Elephas melitensi (Caria, 1965)) On the islands of Sicily and Malta: Elephas (Palaeoloxodon) antiquus...

feet and four on the hind, were that of Elephas (Asian). The trunk had a single trunk finger as seen in Elephas but the trunk length was more similar to...

carried out in the cave until 2007, when the species was given the name Elephas tiliensis. Later studies have generally recognised it as a species of the...

continued to be treated as a species of Elephas by later authors (who sometimes synonymised it with the species "Elephas melitensis" previously named from Maltese...

Jayewardene presents Jayathu to President Reagan on the south lawn Species Elephas maximus Sex Female Born 1983 Sri Lanka Died August 30, 1984 Smithsonian...

Mammuthus meridionalis was originally named by Filippo Nesti in 1825 as Elephas meridionalis based on remains collected from the Upper Valdarno region...

entrance is the family's favourite device of an elephant, with the motto Elephas Indicus culices non timet - 'The Indian elephant does not fear mosquitoes'...

reached sizes equivalent to those of those of the modern Asian elephant (Elephas maximus), though some gomphotheres reached sizes comparable to or somewhat...

fortress / boat Kazakh Т тура (tura) tower Korean R 룩 (rug) Latin T turris / elephas tower / elephant Latvian T tornis tower Lithuanian B bokštas tower Luxembourgish...

with very long beaks and legs and a striking sexual dimorphism. Rhinastus elephas Dupont in Dejean, P.F.M.A., 1836 Rhinastus granulatus Roelofs, W., 1879...

heteracantha, although it is likely that one of the elephant beetles, Megasoma elephas and Megasoma actaeon, or goliath beetles, both of which can commonly exceed...

Akashdeep (February 26, 2024). "Unearthing calf burials among Asian Elephants Elephas maximus Linnaeus, 1758 (Mammalia: Proboscidea: Elephantidae) in northern...

Glitschii Haeckel, 1879 Dianaea endrachtensis Quoy & Gaimard, 1824 Geryones elephas Haeckel, 1879 Geryonia conoides Haeckel, 1864 Geryonia dianaea Haeckel...

debate. In Europe, Curculio elephas may occupy a similar ecological niche as Curculio sayi in North America. Curculio elephas is not as host specific as...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Arikomban Arikomban found sleeping in a tea estate at Chinnakanal Species Elephas maximus (Asian elephant) Sex Male Born 1986/1987 Kerala, India Nationality...

ElefantAsia is a nonprofit organisation protecting the Asian elephant, Elephas maximus. It operates in Laos, which it estimates to have only 1500 Asian...

Stegodon S. bombifrons Tatrot Beds A stegodontid proboscidean. S. insignis S. sp. Saketi Beds Elephas E. planifrons Saketi beds A elephantid proboscidean....

nicknamed Mali, was born in Sri Lanka. Mali was a female Asian elephant (Elephas maximus). Her exact birth date is unknown. She was moved into the Pinnawala...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

studies have shown that these bones belong to Elephas (Palaeoloxodon) antiquus, Elephas mnaidriensis, and Elephas falconeri, so-called dwarf elephants from...

Ziggy Species Indian elephant (Elephas maximus indicus) Sex Male Born c. 1917 Died October 27, 1975 (aged 57–58) Brookfield Zoo, Chicago, Illinois, U...

Kosik (Korean: 코식; born 1990) is a male Indian elephant (Elephas maximus) in the Everland theme park in Yongin, South Korea. He made headlines in September...

Megasoma punctulatum can be around 20 mm. Many Megasoma species (Megasoma elephas, Megasoma thersites, Megasoma gyas, Megasoma cedrosa, Megasoma anubis,...

Bob-cut Sengamalam Sengamalam with her bob-cut hairstyle Species Elephas maximus (Asian Elephant) Sex Female Born c. 1988 (age approx. 38) Likely Assam...

Asian elephant (Elephas maximus indicus). The extended proboscis is called the "trunk" and is used for a wide range of purposes, including eating, drinking...

which was known for harvesting the European spiny lobster (Palinurus elephas) in ancient Roman times. The town itself was named for the legendary figure...

gave the Asian elephant the scientific name Elephas maximus, so the name is sometimes written as "Elephas maximus Linnaeus, 1758". The names of authors...

A Pilgrimage Up the Ganges River to the Source of Hindu Culture (2001) Elephas Maximus: A Portrait of the Indian Elephant (2004) Fantasies of a Bollywood...

genus reached approximately the dimensions of current Asian elephants (Elephas maximus). An individual known from a partial femur head from Yumbo in Colombia...

animal of Thailand. The elephant found in Thailand is the Indian elephant (Elephas maximus indicus), a subspecies of the Asian elephant. In the early-20th...

Baskaran, N. & Desai, A. A. (1996). "Ranging behaviour of the Asian elephant (Elephas maximus) in the Nilgiri Biosphere Reserve, South India" (PDF). SSC Asian...

Thechikottukavu "Raman" Ramachandran Species Elephas maximus (Asian elephant) Sex Male Born c. 1964 (age 61–62) Bihar, India Nationality India Years active...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Kottoor Soman Species Elephas maximus (Asian Elephant) Sex Male Born c. 1942 (age 82) Konni, Kerala, India Nationality Indian Owner Kerala Forest Department...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

produced by Les Films d'Ici (Paris) & GA&A (Rome), Discovery Channel, USA. Elephas Maximus (2005) documentary trilogy directed by Philippe Gautier, written...

Lophodont molars of Elephas (left) and Loxodonta (center), compared to the nonlophodont mastodon (right)...

Shanthi Shanthi and daughter Kumari, April 1994 Species Elephas maximus maximus Sex Female Born 1975 Sri Lanka Died June 26, 2020 (aged 45) Smithsonian...

15 m (10 ft 4 in) Occupation Main casket bearer of the procession of Esala Known for Casket bearer Species Indian elephant (Elephas maximus indicus)...

structure and information content of trumpets in female Asian elephants (Elephas maximus)". PLOS ONE. 16 (11) e0260284. Bibcode:2021PLoSO..1660284F. doi:10...

del Mercure have been discovered remains of pre-historic species such as Elephas antiquus and Hippopotamus major. Rivers and streams include the Lao, Sinni...

Subspecies Borneo elephant (Elephas maximus borneensis) Indian elephant (Elephas maximus indicus) Sri Lankan elephant (Elephas maximus maximus) Florida manatee...

Pradesh Snow leopard Panthera uncia Vulnerable Jharkhand Indian elephant Elephas maximus Endangered Karnataka Kerala Madhya Pradesh Swamp deer Rucervus...

100 hectares (2,700 acres) No. of animals 11 No. of species 2 species: Elephas maximus Loxodonta africana Annual visitors not open to public Website www...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

(Panthera tigris), clouded leopard (Pardofelis nebulosa), Asian elephant (Elephas maximus), Eld's deer (Cervus eldii), gaur (Bos gaurus), Himalayan goral...

Name Binomial name Image Maximum lifespan Elephantidae Asian elephant Elephas maximus 88 years Hominidae Chimpanzee Pan troglodytes 79 years Hominidae...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Choudhury, A.U. (1999). Status and Conservation of the Asian elephant Elephas maximus in north-eastern India. Mammal Review 29(3): 141-173. Choudhury...

Pampady Rajan Pampady Rajan Species Elephas maximus (Asian Elephant) Sex Male Born c. 1977 Kodanadu Forest Range Kerala Nationality Indian Known for Thrissur...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

patterns on the pereiopods; in P. mauritanicus, they are mottled and in P. elephas they are marked with longitudinal stripes, but in P. charlestoni, they...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Balarama Species Elephas maximus (Asian Elephant) Sex Male Born c. 1956 Died 7 May 2023 (aged 67) Bheemanakatte Elephant camp Nationality India Occupation...

Packy One of the elephants at the Oregon Zoo in 2006 Species Elephas maximus Breed Asiatic Elephant Sex Male Born (1962-04-14)April 14, 1962 Oregon Zoo...

characteristics of the vomeronasal organ of the newborn Asian elephant (Elephas maximus)". The Anatomical Record. 267 (3): 252–259. doi:10.1002/ar.10112...

straight-tusked elephant, Palaeoloxodon antiquus (Falconer & Cautley, 1847), Syn.: Elephas antiquus. An exception is the dwarf Middle-Late Pleistocene Sardinian mammoth...

Species Scientific name Ref(s) Proboscidea species Asian elephant Elephas maximus Perissodactyla species Indian rhinoceros Rhinoceros unicornis Carnivora...

Chengalloor Dakshayani Species Elephas maximus (Asian Elephant) Sex Female Born c. 1930 Travancore Died February 5, 2019(2019-02-05) (aged 88–89) Pappanamcode...

Department of Wildlife Conservation in Sri Lanka. Sri Lankan elephants (Elephas maximus maximus) are an endangered species. The Elephant Transit Home within...

as Curculio pellitus, C. venosus and C. elephas are gathered in the "elephas clade". Species in the elephas clade have convex elytra and a dense vestiture...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

habitats in Europe during the Middle Pleistocene. Paleontology portal Elephas recki Mammuthus columbi Palaeoloxodon Larramendi, Asier; Palombo, Maria...

Threats", Jakarta Globe, 2013 "Loxodonta Africana (African elephant)", IUCN "Elephas maximus (Asian elephant, Indian elephant)", IUCN John Ingham, "Elephants...

to 75 mammal species. Threatened species include the Indian elephant (Elephas maximus), wild dog (Cuon alpinus), sloth bear (Melursus ursinus), chousingha...

Ocean Eunephrops bairdii, a crustacean from the Caribbean Sea Palinurus elephas, a crustacean from the eastern Atlantic Ocean and Mediterranean Sea Red...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

ecoregion is home to several large mammals, including Asian elephant (Elephas maximus), tiger (Panthera tigris), clouded leopard (Pardofelis nebulosa)...

CEPF & Taiwan Forestry Bureau] Choudhury, AU (2001), "The wild elephant Elephas maximus in Mizoram", J. Bombay Nat. Hist. Soc., 98 (3): 439–41. Taba Ajum...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

de llagosta. It is made out of local European spiny lobsters (Palinurus elephas, llagosta in Balearic). Menorcan equally, yet far less emblematic, is the...

Chengalloor Ranganathan Species Elephas maximus (Asian Elephant) Sex Male Died 1917 Thrissur Resting place State Museum & Zoo, Thrissur Nationality India...

Elephas maximus sumatranus. In this picture, a mahout was riding an elephant. The elephant was spraying water towards the tree before it. This picture...

Paramekkavu Rajendran Species Elephas maximus (Asian Elephant) Sex Male Born c. 1943 Nilambur forest, Kerala Died 15 October 2019 Paramekkavu Nationality...

943A. doi:10.1007/s10530-007-9094-0. "European spiny lobster (Palinurus elephas)". The Marine Life Information Network. Archived from the original on 7...

76.9 Felis catus Cat Mammalia Carnivora 94 XP_019688936.1 381 72 79.3 Elephas maximus indicus Indian Elephant Mammalia Proboscidea 99 XP_049755695.1...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

include threatened species like the tiger (Panthera tigris), Asian elephant (Elephas maximus), gaur (Bos gaurus), sloth bear (Melursus ursinus), chousingha...

Langbauer; E. M. Thomas (1986). "Infrasonic calls of the Asian elephant (Elephas maximus". Behav. Ecol. Sociobiol. 18 (4): 297–301. Bibcode:1986BEcoS..18...

Elephant Range was established for the protection of the Asian elephant (Elephas maximus). It harbours extensive tracts of bamboo (Melocanna baccifera)...

intact forests support some large mammals, include the Asian elephant (Elephas maximus), tiger (Panthera tigris), gaur (Bos gaurus), banteng (Bos javanicus)...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

"Settlement and juvenile habitat of the European spiny lobster Palinurus elephas (Crustacea : Decapoda : Palinuridae) in the western Mediterranean Sea"...

population of India speak Malayalam. State animal ആന Indian Elephant (Elephas maximus indicus) State bird മലമുഴക്കി വേഴാമ്പൽ Great hornbill (Buceros...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Lorisidae Genus: Loris Order: Proboscidea Family: Elephantidae Genus: Elephas Order: Rodentia Family: Hystricidae Genus: Hystrix Family: Muridae Genus:...

javanica Malayan pangolin Pholidota 94.0 KAI5929482.1 691 74.2% 80.2% Elephas maximus indicus Indian elephant Elephantidae 99.0 XP_049709696.1 717 80...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

notable for their fossil remains of many Devensian mammals, including Elephas primigenius, Tichorhinus antiquitatus and Equus caballus. The landforms...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

characteristics of the vomeronasal organ of the newborn Asian elephant (Elephas maximus)". The Anatomical Record. 267 (3): 252–259. doi:10.1002/ar.10112...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

species, including several large and endangered species – Asian elephant (Elephas maximus), gaur (Bos gaurus), tiger (Panthera tigris), Malayan tapir (Tapirus...

the 3rd century BC. The first, standing at c. 5,50 m, depicts either an Elephas antiquus, [citation needed] or an elephant from the army of Pyrrhus or...

manul) Taman Indah Indian rhinoceros (Rhinoceros unicornis) Asian elephant (Elephas maximus) Indian python (Python molurus) Malayan tapir (Tapirus indicus)...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

is a genus of beetles belonging to the family Scarabaeidae. Brachylepis elephas (Gerstaecker, 1867) Brachylepis turmensis Sehnal, 2018 Brachylepis werneri...

archipelago as a result of a separate migration during the Middle Pleistocene. Elephas aurorae was described by Matsumoto Hikoshichirō in 1918, based on an upper...

1990). "Acute and Fatal Herpesvirus Infection in a Young Asian Elephant (Elephas maximus)". Veterinary Pathology. 27 (2): 131–133. doi:10.1177/030098589002700212...

Highest point Elevation 2,911 m (9,551 ft) Prominence 481 m (1,578 ft) Parent peak Elephas Mountain 2978 m Listing Mountains of Alberta Mountains of British Columbia...

insignis and Palaeoloxodon namadicus are known from Varanasi and Allahabad; Elephas antiquus and Rhinoceros are known from the lower Ganga alluvium. The fauna...

africana 5,200–10,000 kg (11,500–22,000 lb) 2 Asian elephant Elephantidae Elephas maximus: E. m. indicus, E. m. maximus, E. m. sumatranus, E. m. borneensis...

Biosphere Reserve and adjacent areas host the largest Asian elephant (Elephas maximus) population in India, estimated at 5,750 individuals by 2007. Herds...

reach up to 11 cm (4.3 in) in length. Adult elephant beetles, Megasoma elephas and Megasoma actaeon often reach 50 g (1.8 oz) and 10 cm (3.9 in). The...

Goossens, B. (2012). Home range and ranging behaviour of Bornean elephant (Elephas maximus borneensis) females. PLoS One, 7(2), e31400. Stuart, A.J. et al...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Palinurus Temporal range: Albian–Recent PreꞒ Ꞓ O S D C P T J K Pg N Palinurus elephas Scientific classification Kingdom: Animalia Phylum: Arthropoda Clade: Pancrustacea...

Oceans. The Mediterranean Sea: Asteroidea (Common starfish) Palinurus elephas (Spiny lobsters) Scyllarides latus (Mediterranean slipper lobster) Trachinus...

discovered in Ngandong, like the proboscideans Stegodon trigonocephalus and Elephas hysudrindicus, the bovines Bubalus palaeokerabau and Bos palaesondaicus...

Anne Anne in 2019 Species Asian elephant (Elephas maximus) Sex Female Born Early 1950s Sri Lanka Occupation Circus elephant (1956–2011) Residence Longleat...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

North African elephant (Loxodonta africana pharaoensis), Chinese elephant (Elephas maximus rubridens), cave bear (Ursus spelaeus), Straight tusked elephant...

Paleontology and Vulcanology holds the integral unburied skeleton of an Elephas falconeri in an excellent state of conservation. The first inhabitants...

warm period fauna from Sarstedt include Hippopotamus, Cervus elaphus, and Elephas antiquus. In 2001, three skull fragments were reported to have been discovered...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

dentipes W.Roelofs, 1874 Curculio distinguendus Gyllenhal 1834 Curculio elephas (Gyllenhal 1836) (chestnut weevil) Curculio fulvus Chittenden, 1927 Curculio...

fauna (around 700,000 years ago), consisting of parts of a skeleton of Elephas meridionalis and of a skeleton of an Antiquus hippopotamus, as well as...

Sulawesi dwarf elephant Elephas celebensis Sulawesi Extinct (Early Pleistocene) Asian elephant Cabarruyan dwarf elephant Elephas beyeri Luzon Extinct Cretan...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

subspecies, elephants Hypselephas hysudricus, Palaeoloxodon namadicus, and Elephas maximus sinhaleyus, and the hippopotamus Hexaprotodon sivalensis. Asiatic...

Thomas, Elizabeth M. (1986). "Infrasonic calls of the Asian elephant (Elephas maximus)". Behavioral Ecology and Sociobiology. 18 (4): 297–301. Bibcode:1986BEcoS...

and provide the highest landscape connectivity for the Asian elephant (Elephas maximus) population in the region. Mudumalai National Park receives about...

York Press. pp. 77–78. ISBN 978-0-7914-2439-1. Alter, Stephen (2004). Elephas Maximus: a portrait of the Indian Elephant. New Delhi: Penguin Books. p...

Maryland Zoo African elephant Elephas africana 2024 1 Elderly animal United States National Zoo Asian elephant Elephas maximus 2024 1 Kamala Elderly animal...

the greater tuberosity, but it is not as developed as in Uintatherium or Elephas. The bones of the forelimb are not coossified, and the ulna is far more...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

home to several large and endangered mammal species – Asian elephant (Elephas maximus), gaur (Bos gaurus), tiger (Panthera tigris), sun bear (Helarctos...

E. antiquus may refer to: Elephas antiquus, the straight-tusked elephant, an extinct species of elephant closely related to the living Asian elephant...

endotheliotropic herpes virus discovered in a group of captive Asian elephants (Elephas maximus)". Journal of Zoo and Wildlife Medicine. 41 (4): 626–632. doi:10...

documented name and large size, has been speculated to be a Syrian elephant (Elephas maximus asurus), which was a subspecies of the Asian elephant that became...

(Tapirus indicus), clouded leopards (Neofelis nebulosa), Asian elephants (Elephas maximus), and previously also Sumatran rhinoceroses (Dicerorhinus sumatrensis)...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

of elephant kills of any country in the world. The Sri Lankan elephant (Elephas maximus maximus) is a subspecies of the Asian elephant, native to Sri Lanka...

western Mediterranean Sea. The pink spiny lobster differs from Palinurus elephas, by its first pair of pereiopods (walking legs) that are as slender as...

are known, the elephant beetles of Central and South America, (Megasoma elephas) and (M. actaeon), the Titan beetle (Titanus giganteus) of the neotropical...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Reservoir Kundala Dam Kundala Dam reservoir Meesapulimala mountain Wild Elephas in Kannan Devan Hills Kanan Devan Hills Plantations Company Munnar Plantation...

(1857). "Description of the foetal membranes and placenta of the elephant (Elephas Indicus, Cuv.), with remarks on the value of placentary characters in the...

population structure of megaherbivores (gaur Bos gaurus and Asian elephant Elephas maximus) in a deciduous habitat of Western Ghats, India". Mammal Study...

Crocodylus suchus lalo lálò Jews' mallow Corchorus olitorius lɨng lɨŋ̂ elephant Elephas maximus maiwa màjwā millet sp. mam bakin mám bàkìn aerial yam Dioscorea...

eight to 17 individuals as of March 2021. In 2011, the Asian elephant (Elephas maximus) was thought to migrate seasonally from Uttar Pradesh through the...

home to over 183 species of mammals. They include the Asian elephant (Elephas maxiumus), tiger (Panthera tigris), Asian black bear (Ursus thibetanus)...

didactylus Two-toed sloth XP_037701005.1 196 99 88.8 92.9 Proboscidea Elephas maximus indicus Indian elephant XP_049738921.1 197 99 89.3 94.9 Cingulata...

size from the Eurasian pygmy shrew (Sorex minutus) to the Asian elephant (Elephas maximus). They include nocturnal small mammals endemic to India such as...

animal) Platanista gangetica Indian elephant (national heritage animal) Elephas maximus indicus  Indonesia Komodo dragon (national animal) Varanus komodoensis...

extender and cryoprotectant on the post-thaw quality of Asian elephant (Elephas maximus indicus) semen" (PDF). Cryobiology. 66 (1): 52–59. doi:10.1016/j...

including the giant panda ancestor Ailuropoda baconi, the Asian elephant (Elephas maximus), the "giant tapir" (Tapirus augustus), the extinct elephant-relative...

invertebrates Crustacean Crayfish, crawfish or spiny lobster Palinurus elephas Marine invertebrates Crustacean Little whirlpool ram's-horn snail Anisus...

Mammalia Afrotheria Echinops telfairi, Tenrec ecaudatus Mammalia Afrotheria Elephas maximus, Loxodonta africana Mammalia Laurasiatheria Talpa occidentalis...

in the River Mountains Plants Stones/Other Reference Hydaspes India Yes Elephas [river] "like a heliotrope" used to prevent sunburn [river] precious stone...

and keras ('horn'), and similarly between elephairomai ('deceive') and elephas ('ivory'). This resemblance either made it seemingly appear as if the verbs...

the largest living land animals. Family: Elephantidae (elephants) Genus: Elephas Asian elephant, E. maximus EN Indian elephant, E. m. indicus The treeshrews...

species from 65 genera and 10 orders, including such species as elephant (Elephas maximus), bear (Melursus ursinus), binturong (Arctictis binturong), wild...

(monkeys and apes), Lemur (lemurs and colugos) and Vespertilio (bats) Bruta: Elephas (elephants), Trichechus (manatees), Bradypus (sloths), Myrmecophaga (anteaters)...

"Distribution of haplotypes and microsatellite alleles among Asian elephants (Elephas maximus) in Thailand". European Journal of Wildlife Research. 53 (4): 298–303...

Arisaema ehimense J.Murata & J.Ohno 1989 Pistillata Japan (Shikoku). Arisaema elephas Buchet 1911 Arisaema China (Gansu, Guizhou, Sichuan, Xizang, Yunnan), Bhutan...

Pollicaria contains six species: Pollicaria arlingi Thach, 2018 Pollicaria elephas (Morgan, 1885) - endemic to limestone outcrops in Perak, Peninsular Malaysia...

Guruvayur Padmanabhan Padmanabhan in 2011 Species Elephas maximus (Asian Elephant) Sex Male Born 1940s Nilambur, Kerala Died 26 February 2020 Guruvayur...

(Caprolagus hispidus) Dhole (Cuon alpinus) Asian elephant (Elephas maximus) Indian elephant (Elephas maximus indicus) Onager (Equus hemionus) Woolly flying...

(probably the extinct Palaeoloxodon recki), a smaller elephant (probably Elephas hysudricus, the ancestor of the living Asian elephant), the extinct narrow-nosed...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Delphinus delphis Asian elephant 6,775,000,000^ Estimated Pallium (cortex) Elephas maximus Chimpanzee 7,400,000,000* Optical fractionator Pallium (cortex)...

molars of Elephas jolensis from the Pleistocene Kibish Formation (Kenya) and on the timing and causes of extinction of members of the genus Elephas in Africa...

Gangetic Plain harboured impressive populations of wild Asian elephants (Elephas maximus), Bengal tigers (Panthera t. tigris), Indian rhinoceros (Rhinoceros...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

consequences of pathogen avoidance behavior across species. Asian elephants (Elephas maximus) use branches to deter biting flies from areas of the body with...

The native elephants of Kerala are Indian elephants (Elephas maximus indicus), one of three recognized subspecies of the Asian elephant. Since 1986, Asian...

Consulting Group and Independent Board Member at Biocryst Pharmaceuticals and Elephas Biosciences. Until 2021 he was Senior Vice President for Research and Development...

flexibility and differential survival of Pleistocene Stegodon orientalis and Elephas maximus in mainland southeast Asia revealed by stable isotope (C, O) analysis"...

Several large endangered mammals inhabit the peninsula – Asian elephant (Elephas maximus), gaur (Bos gaurus), tiger (Panthera tigris), sun bear (Helarctos...

Trachysomus verrucosus (Olivier, 1797) Synonyms Cerambyx dromedarius Voet, 1781 (Unav.) Lamia verrucosa Olivier, 1797 Trachysomus elephas Buquet, 1852...

helper, and Judy Placido (17), a recent high school graduate, had left the Elephas discotheque in Bayside, Queens, and were sitting in Lupo's parked car at...

preserved in the fossil record. For most of the Middle Pleistocene during the "Elephas falconeri" faunal complex, Leithia was one of a small number of mammal...

secretions of male muskoxen (Ovibos moschatus) or Asian bull elephants (Elephas maximus). Gum benzoin contains up to 20% of benzoic acid and 40% benzoic...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Mangalamkunnu Karnan (Nilavinte Thampuran) Species Elephas maximus (Asian Elephant) Sex Male Born 1957–1961 Bihar, India Died 28 January 2021 (aged 60-63)...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

, Szafer, W. & Schille, F., 1914. Wykopaliska staruńskie. Słoń mamut (Elephas primigenius Blum.) i nosorożec włochaty (Rhinoceros antiquitatis Blum....

park is inhabited by a herd of 150 Sri Lankan elephants. Marsh elephant (Elephas maximus vil-aliya) roams in the Mahaweli River area. Both monkeys found...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

; Fernando, P.; Hedges, S.; Gunawardena, M.; Kurt, F.; et al. (2008). "Elephas maximus". IUCN Red List of Threatened Species. 2008 e.T7140A12828813. doi:10...

ISBN 978-0-8134-2883-3. OCLC 21977751., pp. 46–50 "Lin Wang, an Asian elephant (Elephas maximus) at Taipei Zoo". Retrieved 2009-08-13. "International Nishikigoi...

ecology Elephantidae (elephant) J. E. Gray, 1821 3 species in 2 genera Elephas (1 species) Loxodonta (2 species, African bush elephant pictured) Sub-Saharan...

Trichechus manatus Florida manatee Afrotheria 99.0 XP_023582938.1 380 82.1 88.9 Elephas maximus indicus Elephant Afrotheria 99.0 XP_049734871.1 392 76.7 84.8 Choloepus...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Pleistocene proboscideans from southern China (Sinomastodon, Stegodon, Elephas), by means of dental microwear texture analysis". Quaternary International...

Nepal Arisaema dahaiense H. Li 1977 China (Yunnan), Myanmar Arisaema elephas Buchet 1911 China (Gansu, Guizhou, Sichuan, Xizang, Yunnan), Bhutan, Myanmar...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Asian Elephants (Elephas maximus) at the Elephant Reserve...

Metanephrops challengeri Thenus orientalis Nephrops norvegicus Palinurus elephas Panulirus argus Panulirus cygnus Panulirus echinatus Panulirus guttatus...

Hymenogastraceae. Found in Thailand, where it grows on the rotting dung of Elephas, it was described as new to science in 2009. List of psilocybin mushrooms...

ತನುಜಾತೆ Officially declared on 6 January 2004. State animal Asian elephant (Elephas maximus) ಏಷ್ಯನ್ ಆನೆ State bird Indian roller|blue jay (Coracias indica)...

DIDGDGQVNYEEFVQMMTAK* >gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus] LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV...

tiger (Panthera tigris) and large herbivores such as the Asian elephant (Elephas maximus). Ungulates such as the four-horned antelope (Tetracerus quadricornis)...

revealing similarities with modern relatives like the Asian elephant (Elephas maximus). Epigenetic Insights: By identifying preserved chromatin interactions...

Dilophus dubius Elmo Hardy, 1982 Dilophus edwardsi (Hardy, 1948) Dilophus elephas Edwards, 1935 Dilophus emarginatus Mcatee, 1922 Dilophus ephippium (Philippi...

Carnivora Phocidae Pusa hispida Ringed seal 环海豹 II 06 Proboscidea Elephantidae Elephas maximus Asian elephant 亚洲象 I 03 I Perissodactyla Equidae Equus ferus Przewalski's...

Procavia capensis, Rock hyrax, (2011) Family Elephantidae (Elephants) Elephas maximus, Asian elephant, (2015, 2024) † Mammuthus primigenius, Wooly mammoth...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Hipposideros armiger Great roundleaf bat Chiroptera 94 XP_019494952 916 60.9 53.2 Elephas maximus indicus Indian Elephant Proboscidea 99 XP_049755600 937 61.1 52...

Sri Lankan elephant (Elephas maximus maximus), the largest of the subspecies of Asian elephant...

matter), a robot called Tonda skilled in electronics, a human doctor called Elephas, and a spaceship called Tolma. Oudeis and his companions land on a planet...

Hieroglyphic Luwian ti-pa-s 'sky; bowl, cup' (cf. Hittite nēpis 'sky; cup'); eléphās 'ivory', from Hittite laḫpa (itself from Mesopotamia; cf. Phoenician ʾlp...

Several of the sectors support significant populations of Asian elephants (Elephas maximus). The sectors of the ecoregion tend to be bounded on the south...

buffalo (Bubalus arnee), India's largest population of Asian elephants (Elephas maximus) and the world's largest population of Indian rhinoceros, while...

number of endemic species. Threatened mammal species include elephant Elephas maximus, of which there were 150-200 before the establishment of the park...

natural cast of the brain, defences and molar teeth) of the dwarf elephant, Elephas falconeri, the spheric eggs and the fossilized armour of a big tortoise...

Larry/Dirk – A human lightweight wrestler. Elepha/Mastodon – An anthropomorphic elephant. Flamer/Equus – An anthropomorphic kickboxing horse. Morin – An...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

McDougall, Pam (July 1988). ""Chanda" - Canada's first Asian elephant (Elephas maximus)". Animal Keeper's Forum. American Association of Zoo Keepers:...

Asian elephants (Elephas maximus) at Smithsonian National Zoo...

Pontella edwardsii (Kroyer, 1849) Pontella elegans (Claus, 1892) Pontella elephas Brady, 1883 Pontella emerita Dana, 1849 Pontella eugeniae Leuckart, 1859...

biological names: Cervus elaphus (red deer) Lucanus elaphus (giant stag beetle) Elephas, a genus of elephants This disambiguation page lists articles associated...

instrumental and vocal recordings are provided. National animal Asian elephant (Elephas maximus) ช้างเอเชีย One of three national symbols proclaimed in a declaration...

(Rhinoceros unicornis) Wild water buffalo (Bubalus arnee) Indian elephant (Elephas maximus indicus) Royal Bengal tiger (Panthera tigris tigris) Indian boar...

gorillas who passed the MSR test under these circumstances. Asian elephant (Elephas maximus): In a study performed in 2006, three female Asian elephants were...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

axis Chital/Spotted deer 2. Mammal Axis porcinus Indian Hog deer 3. Mammal Muntiacus muntjak Indian muntjac 4. Mammal Elephas maximus Asian elephant...

probably transmitted by M. castanicola aphids. The chestnut weevil (Curculio elephas) most often damages the fruit. In Hungary, it swarms in chestnut orchards...

(Panthera tigris), Indian rhinoceros (Rhinoceros unicornis), Asian elephant (Elephas maximus), wild water buffalo (Bubalus arnee), chousingha (Tetracerus quadricornis)...

Chilihueque, Lama araucana Chinese elephant, Elephas maximus rubridens Giraffa sahara Javan elephant, Elephas maximus sondaicus Kallana Long-necked seal...

S2CID 253949585. Wilson, D. E.; Reeder, D. M., eds. (2005). "Species Elephas maximus". Mammal Species of the World: A Taxonomic and Geographic Reference...

(2003-06-01), "Frontalin: a Chemical Message of Musth in Asian Elephants (Elephas maximus)", Chemical Senses, vol. 28, no. 5, pp. 433–446, doi:10.1093/chemse/28...

American coati (Nasua nasua). Jena and Praya, the two Asian elephants (Elephas maximus). California sea lion (Zalophus californianus) Humboldt penguins...

Thrikkadavoor Sivaraju Species Elephas maximus (Asian Elephant) Sex Male Born c. 1973 Konni forest, Kerala Nationality India Known for Poorams Owner Travancore...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

conclamatum Omicron criticum Omicron deminutum Omicron deplanatum Omicron elephas Omicron flavonigrum Omicron foxi Omicron furiosum Omicron garrulum Omicron...

mongoose Herpestes semitorquatus, collared mongoose Dugong dugon, dugong Elephas maximus borneensis, Borneo elephant Bornean rhinoceros, Dicerorhinus sumatrensis...

indica) Common jasmine (Jasminum officinale) Karnataka Indian elephant (Elephas maximus) Indian roller (Coracias indica) Sandalwood (Santalum album) Mango...

American flamingos featured at the entrance to the zoo Asian elephant (Elephas maximus) Children playing on a giraffe statue at the zoo Southern white...

Hippopotamus cf. gorgops bones along with those of the large elephant Elephas cf. recki to create bone tools. As of 2025, these are currently the oldest...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

the largest living land animals. Family: Elephantidae (elephants) Genus: Elephas Asian elephant, E. maximus EN Rodents make up the largest order of mammals...

histomorphology of Pacinian corpuscles in the foot of the Asian elephant (Elephas maximus) and their potential role in seismic communication". Journal of...

day Jharkhand Foundation Day (15 November) State animal Indian elephant (Elephas maximus indicus) State bird Asian koel (Eudynamys scolopaceus) State fish...

on the Remains of Elephas cypriotes from a Cave-Deposit in Cyprus (1905) On Elephant Remains from Crete, with Description of Elephas creticus (1907) Excavation...

Sparisoma cretense Muraena helena Anemonia viridis Scorpaena porcus Palinurus elephas Anthozoa Shark ontogeny Prionace glauca Mobula mobular Sphyrna zygaena...

collections include remains of giant turtle, tusks, fossils, molar of Elephas sp., tradeware ceramics and paintings. Wikimedia Commons has media related...

with extensive tracts of grassland.[citation needed] The Indian elephant (Elephas Maximus) is the major threatened species found in the sanctuary. They are...

Asiatic Wild Dog (Cuon alpinus), Banteng (Bos javanicus), Asian Elephant (Elephas maximus), Yellow/Elongated Tortoise (Indotestudo elongata), and the endangered...

Curculio elephas, a beetle described by Gyllenhaal...

Seelamantula, C. S.; Sukumar, R. (2009). "Vocalizations of wild Asian elephants (Elephas maximus): structural classification and social context". The Journal of...

elephants (Loxodonta africana and Loxodonta cyclotis) and the Asian elephant (Elephas maximus). Mammut americanum had a widespread distribution during the Pleistocene...

Padayappa Padayappa in a tea plantation Species Elephas maximus (Asian elephant) Sex Male Born unknown Nationality India Known for Frequent appearances...

atra are rare birds inhabit in the national park. A few Asian elephants (Elephas maximus) still inhabit the forests of Bundala. Other mammals seen in the...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

of (Z)-7-dodecen-1-yl acetate as a sex pheromone by the Asian elephant (Elephas maximus) and by more than 100 species of Lepidoptera. The biosynthesis...

the Middle Ages with the name ad Elephantus – from a bronze statue of Elephas herbarius which rose nearby in Roman times, as an emblem of the adjacent...

"Manual collection and characterization of semen from Asian elephants (Elephas maximus)." Animal reproduction science 53.1 (1998): 309–314. Brown, Janine...

keu) 체크메이트 (che keu me i teu) Latin R rex king D domina queen T turris / elephas tower / elephant S signifer / cursor / stultus / alphinus standard-bearer...

include: Sunda flying lemur (colugo) Galeopterus variegatus Asian elephant Elephas maximus (Proboscidea) - EN Sunda pangolin Manis javanica (Pholidota) -...

tools with their trunk and feet. Both wild and captive Asian elephants (Elephas maximus) use branches to swat flies or scratch themselves. Eight of 13...

the endangered Red panda Ailurus fulgens, the endangered Asian elephant Elephas maximus, and vulnerable Takin Budorcas taxicolor. Officially protected...

Retrieved 29 November 2025. Choudhury, A.U. (2001) The wild elephant Elephas maximus in Mizoram. J. Bombay nat. Hist. Soc. 98(3): 439–441 "Six new species...

echidnoides Vilvens, 2007 Calliotropis effossima (Locard, 1898) Calliotropis elephas Vilvens, 2007 Calliotropis eltanini Dell, 1990 Calliotropis enantioserrata...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

species do not appear to compete for food or habitat. Asian elephants (Elephas maximus) and Sumatran rhinos are even known to share trails, and many smaller...

B. Burch, 1999 Hypselostoma edentulum Moellendorff, 1894 Hypselostoma elephas van Benthem Jutting, 1950 Hypselostoma emergens van Benthem Jutting, 1950...

(Ursus thibetanus), Malayan tapir (Tapirus indicus), Indian elephant (Elephas maximus indicus), gaur (Bos gaurus), hog deer (Cervus porcinus), sambar...

Cervus elaphus Persian fallow deer, Dama mesopotamica Syrian elephant, Elephas maximus asurus Onager, Equus hemionus Arabian oryx, Oryx leucoryx Lion...

Patterson, 1990 Percolomonas descissus Larsen & Patterson, 1990 Percolomonas elephas Larsen & Patterson, 1990 Percolomonas Fenchel & Patterson, 1986 Percolomonas...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

review of the status, distribution and biology of wild Asian elephants Elephas maximus". International Zoo Yearbook. 40 (1): 1–8. doi:10.1111/j.1748-1090...

Japanese): 67. Ōtsuka Yanosuke (1941). "On the stratigraphic horizon of Elephas from Miyako Is., Ryūkyū Islands, Japan". Proceedings of the Imperial Academy...

R, et al. (November 2006). "Results of Vaccination of Asian Elephants (Elephas Maximus) With Monovalent Inactivated Rabies Vaccine". American Journal...

(Python molurus), clouded leopard (Neofelis nebulosa), Indian elephant (Elephas maximus indicus) and crocodiles, which live in the Sundarbans. Approximately...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

elephant to King Louis XV. The elephant was a two-year-old Asian elephant (Elephas maximus), which left Bengal, India for France on ship which belonged to...

of 2017) A grey crowned crane (Balearica regulorumin) Asian elephants (Elephas maximus) in the grounds of the new Elephant House A hamadryas baboon (Papio...

Gen - Mr. Pak, Narrator Casshan: Robot Hunter - Akubon Dinozaurs - Drago Elephas Doomed Megalopolis - Kamo Katy Caterpillar - Boss Bee Lupin the 3rd: The...

and lithographs. Hunting Companions, 1860, in the Rijksmuseum, Amsterdam Elephas maximus, print, 1849, in the collections of the University of Amsterdam...

Wikramanayake, E.; et al. (IUCN SSC Asian Elephant Specialist Group) (2008). "Elephas maximus". IUCN Red List of Threatened Species. 2008 e.T7140A12828813. doi:10...

star Peltaster placenta, squat lobsters and the spiny lobster Palinurus elephas. The ecosystem is easily damaged by deep water fishing activities including...

alongside species such as the giant tapir Tapirus augustus,the Asian elephant (Elephas maximus) the extinct elephant-relative Stegodon orientalis, the Sumatran...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

of India. "Report on the Welfare & Veterinary Status Captive Elephants (Elephas maximus) at Punnathur Kotta" (PDF). cupabangalore.org. Archived from the...

Pamphagus djelfensis Vosseler, 1902 Pamphagus elephas (Linnaeus, 1758) - type species (as Gryllus elephas L. by subsequent designation) Pamphagus marmoratus...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

Chen, Y.-H. Liu & W.-X. Wu, 1995 Boysidia dorsata (Ancey, 1881) Boysidia elephas (van Benthem Jutting, 1950) Boysidia fengxianensis D.-N. Chen, Y.-H. Liu...

spiny lobster Palinurus gilchristi 734 Common spiny lobster Palinurus elephas 449 Tristan da Cunha rock lobster Jasus tristani 403 St. Paul rock lobster...

Sarkar, P., Verma, S. and Menon, V. 2012. Food selection by Asian elephant (Elephas maximus). The Clarion-International Multidisciplinary Journal 1: 70-79...

Pedicularis elephantiflora T.Yamaz. Pedicularis elephantoides Benth. Pedicularis elephas Boiss. Pedicularis elisabethae T.N.Popova Pedicularis elliotii P.C.Tsoong...

when he scientifically described and named the Asian elephant species, Elephas maximus, in 1758 in the 10th edition of Systema Naturae. In 2014, The skeleton...

Palinurus elephas Palinuridae...

species, the Bengal tiger (Panthera tigris tigris), the Indian elephant (Elephas maximus indicus), whose populations have recently dwindled and may have...

found in three locations in Hove: an 11-pound-2-ounce (5.0 kg) molar from Elephas antiquus, excavated from the garden of a house in Poplar Avenue; teeth...

(Sturnus erythropygius). Introduced species include the Asian elephant (Elephas maximus) and chital (Axis axis) apart from ferals. There are 28 reptile...

investigated the caves at Malta and obtained remains of the pygmy elephant (Elephas melitensis), which was described by Hugh Falconer. He investigated the...

caribou (Rangifer sp.), elk (Cervus canadensis), woolly mammoth (Elephas primigenius and Elephas columbi), and horse (Equus spp.). These fossils were dated...

the PanAfrican Archaeological Association from 1959 to 1963. (1942) "L’ Elephas recki Dietrich. Exposition systématique et ses affinités". Bull. Soc. géol...

remains found at Isimila include the species of prehistoric Elephants (Elephas recki), Rhinos (Diceros bicornis), Zebra (Equus cf. burchelli), Bovids...

interspersed with some grassland. The reserve provides habitat to Asian elephant (Elephas maximus) and Gurney's pitta (Hydrornis gurneyi). It was gazetted in 2005...

Kongad Kuttisankaran Species Elephas maximus (Asian Elephant) Sex Male Born c. 1962 Nilambur, Kerala Died 26 July 2020(2020-07-26) (aged 57–58) Nationality...

manatus latirostris Florida Manatee Sirenia 99 XP_004379276.3 402 78.4 88.1 Elephas maximus indicus Indian Elephant Proboscideans 99 XP_049723395.1 402 78...

"Interventions in the Greater Bay: Reconstructing the Archives of Big Tail Elepha". Art Basel. Big-Tail Elephant. Bern: Kunsthalle Bern, 1998. "Made in the...

Elephas ganesa, a fossil elephant from the Siwaliks...

Schedule I Vulnerable Gaur (Bos gaurus) Schedule I Vulnerable Asian elephant (Elephas maximus) Schedule I Endangered Serow (Capricornis thar) Schedule I Near...

dune snail (Helminthoglypta walkeriana) Hirinaba curytibana Hypselostoma elephas Magazine Mountain middle-toothed snail (Inflectarius magazinensis) Lampedusa...

(MF&SF Dec. 1950) 8. "The Better Mousetrap" 5. "Elephas Frumenti" (MF&SF Win./Spr. 1950) 2. "Elephas Frumenti" 6. "Beasts of Bourbon" (MF&SF Oct. 1951)...

example, E. Pfitzenmayer, "A Contribution to the Morphology of the Mammoth, Elephas Primigenius Blumenbach; With an Explanation of My Attempt at a Restoration...

biodiversity and ecological significance. Source: Sri Lankan elephant (Elephas maximus maximus) Sri Lankan leopard (Panthera pardus kotiya) Sri Lankan...

(Northern Afar Depression, Eritrea) with remarks on the systematics of Elephas recki (Proboscidea, Elephantidae). Journal of Vertebrate Paleontology....

forests are home to most of the Sri Lanka's 6000 Sri Lankan elephants (Elephas maximus maximus), the island's indigenous subspecies of Asian elephant...

Title Symbol Media Notes National animal Sri Lankan elephant (Elephas maximus maximus) There is no official national animal in Sri Lanka even though the...

Square-tailed drongo-cuckoo (Surniculus lugubris) NT Sri Lankan elephant (Elephas maximus maximus) EN Sri Lankan leopard (Panthera pardus kotiya) EN Sri...

Guruvayur Keshavan Guruvayur Keshavan's statue Species Elephas maximus (Asian Elephant) Sex Male Born c. 1912 Kerala Died December 2, 1976(1976-12-02)...

(Leontopithecus rosalia), the African elephant (Loxodonta sp.) and Asian elephant (Elephas maximus). However, because flagship species are selected according to the...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

position so that it could retrieve a banana. More recently, Asian elephants (Elephas maximus) were shown to exhibit similar insightful problem solving. A male...

2021, it has been listed as Critically Endangered on the IUCN Red List. Elephas (Loxodonta) cyclotis was the scientific name proposed by Paul Matschie...

William R.; Thomas, E. M. (1986). "Infrasonic calls of the Asian elephant (Elephas maximus)". Behavioral Ecology and Sociobiology. 18 (4): 297–301. Bibcode:1986BEcoS...

mammals, including the douc langur, tiger (Panthera tigris), Asian elephant (Elephas maximus), gaur (Bos gaurus), banteng (Bos javanicus), mainland serow (Capricornis...

fauna. Confirmed or regularly observed species include: Indian elephant (Elephas maximus) Leopard (Panthera pardus) leopard cat (Prionailurus bengalensis)...

species. Larger mammals include tiger (Panthera tigris), Asian elephant (Elephas maximus), gaur (Bos gaurus), banteng (Bos javanicus), wild water buffalo...

Preferred habitat IUCN status Range Family Elephantidae: elephants Asian elephant Elephas maximus Linnaeus, 1758 Forest, shrubland, grassland EN IUCN...

support viable populations of most larger mammals, including Asian elephant (Elephas maximus), tiger (Panthera tigris) sloth bear (Melursus ursinus), gaur (Bos...

Asian elephants (Elephas maximus indicus)...

bicornis minor Black Rhino Perissodactyla 94 XP_058403718 181 18.80% 24% Elephas maximus indicus Indian Elephant Proboscidea 99 XP_049723476 145 23.80%...

Reserve Forest, which are used as dispersal areas through tea gardens (Elephas maximus). Three extensive tea gardens that belong to the estates of Dissoi...

cytogenetics of the African elephant (Loxodonta africana) and Asiatic elephant (Elephas maximus)". Cytogenetics and Cell Genetics. 93 (3–4): 249–52. doi:10.1159/000056992...

chimpanzee species (Pan spp.), tigers (Panthera tigris sp.), Asian elephant (Elephas maximus), snow leopard (Panthera uncia), red-shanked douc (Pygathrix nemaeus)...

National Park: Moving Towards an Integrated Approach for Asian Elephant (Elephas maximus) Conservation". Journal of Human Ecology. 28 (3). SERC Division...

Easa, P.S.; Kumar, A.; Baskaran, N.; Yoganand, K. & Menon, V. (2020). "Elephas maximus". IUCN Red List of Threatened Species. 2020 e.T7140A45818198. Marsh...

Death of an elephant (Elephas maximus Linn.) while calfing. J. Bombay Nat. Hist. Soc. 37(3):722. 1934: Death of 14 elephants (Elephas maximus Linn.) by food...

Star-nosed mole XP_004687557.1 94 267 61.7 73.7 38.3 48.3 Proboscideans Elephas maximus indicus Indian elephant XP_049761646.1 99 266 73.6 82.1 26.4 30...

University of Burgos (2007) Meléndez, B. y Aguirre, E. (1958): «Hallazgo de Elephas en la terraza media del río Manzanares (Villaverde, Madrid)». Las Ciencias...

chronic and debilitating disease, often referred to as lepra or morbus elephas. It was caused by the bacterium Mycobacterium leprae, which primarily targeted...

hoof-like nails; move slowly and eat mostly masticated vegetables. Elephas – elephants Elephas maximus – Asian elephant Trichechus – herbivorus marine mammals...

Synagris calida (Linnaeus, 1758) Synagris crassipes Kohl, 1894 Synagris elephas Andre, 1895 Synagris fasciata Mocsary, 1903 Synagris kohli Maidl, 1914...

range of species, with many threatened ones, including Asian Elephants (Elephas maximus indicus), Tiger (Panthera tigris), Asian Golden Cat (Catopuma temminckii)...

and even other predators such as leopards and bears. Elephant calves (Elephas maximus) may be prey. The tiger is estimated to have been present in India...

the largest living land animals. Family: Elephantidae (elephants) Genus: Elephas Asian elephant, E. maximus EN Rodents make up the largest order of mammals...

Pleistocene proboscideans from southern China ( Sinomastodon , Stegodon , Elephas ), by means of dental microwear texture analysis". Quaternary International...

Elephant Encyclopedia. Retrieved 20 February 2012. "Raja, an Asian elephant (Elephas maximus) at Pinnawala elephant orphanage in Sri Lanka". elephant.se. Koehl...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

discovered at Zhiren Cave include those from Pongo pygmaeus, Elephas kiangnanensis, Elephas maximus, Megatapirus augustus, Rhinoceros sinensis, Megalovis...

Sharif) are primarily herbivores and include proboscideans such as Elephas hysudricus, Elephas planifrons, and several species of Stegodon; the bovids Boselaphus...

Sanctuary provides habitat for over 30 mammals including Asian elephant (Elephas maximus), gaur (Bos gaurus), mainland serow (Capricornis milneedwardsii)...

Okaka-okaka published by Cacho Publishing House. Sina Elephas At Estegodon Noon Unang Panahon (Elephas and Estegodon [Two Mammoths during Primeval Times])...

Chirakkal Kalidasan Species Elephas maximus (Asian elephant) Sex Male Born c. 1980 Karnataka Nationality India Known for Thrissur Pooram Baahubali 2 Owner...

Choudhury, A.U. (1999). Status and Conservation of the Asian elephant Elephas maximus in north-eastern India. Mammal Review 29(3): 141–173. Choudhury...

the Show Yūjirō Someya I'm the Villainess, So I'm Taming the Final Boss Elephas Levi My Hero Academia 6th Season Tomura Shigaraki Orient Akihiro Shimazu...

(rock-dwelling) lichen that grows in the high Andean forest zone of Colombia. Cora elephas is a closely related species. Cora aturucoa is a basidiolichen in the family...

known or suspected to live in Phou Hin Poun include the Indian elephant (Elephas maximus indicus), the Indochinese tiger (Panthera tigris corbetti), the...

commented "the situation is half-humorous, half-ironic". Javan elephant (Elephas maximus sondaicus) was described in 1955 based on an illustration of a...

Retrieved 11 December 2024. "uncharacterized protein C17orf107 homolog [Elephas maximus indicus]". National Library of Medicine. Retrieved 11 December...

fig trees and laurels. The animals characteristic of the epoch are the Elephas antiquus, the Rhinoceros, the cave bear, the striped hyaena and the hippopotamus:...

bellianus is caught as bycatch by artisan fishermen targeting Palinurus elephas, and as much as 10 t can be caught annually. Charles Fransen (June 12,...

Government of British Columbia – B.C. Geographical Names Office (BCGNO). "Elephas Mountain". BC Geographical Names. Government of British Columbia – B.C...

contains earthenware fragments and remains of animals such as turtles and Elephas sp. The area was inhabited by both Tagalog and Aeta peoples before the...

Larger mammals include the tiger (Panthera tigris), Asian elephant (Elephas elephas), gaur (Bos gaurus), Nilgiri langur (Semnopithecus johnii), dhole or...

the Whistler Film Festival Has Come To Mean Business", Variety, 2015 "Elephas maximus (Asian elephant, Indian elephant)", IUCN Red List of Threatened...

Cercopithecoides), proboscideans (the deinothere Deinotherium and elephants Elephas, Loxodonta, and Mammuthus) old world porcupines (Hystrix and Xenohystrix)...

 Amanita eijii  Amanita elata  Amanita electra  Amanita elegans  Amanita elephas  Amanita elliptica  Amanita elongatospora  Amanita emodotrygon  Amanita...

substantial areas around Malai Mahadeshwara Hills. The Indian Elephant (Elephas maximus) inhabits the sanctuary. After the creation of the sanctuary in...

(2019) Deforestation increases frequency of incidents with elephants (Elephas maximus). Tropical Conservation Science. 12, 1-11, doi.org/10.1177/1940082919865959...

Egypt: American University in Cairo Press. pp. 216–217. ISBN 9789774164781. Elephas maximus asurus. Wilford, John Noble (September 18, 1984). "The Mystery...

Choudhury, A.U. (1999). Status and conservation of the Asian elephant Elephas maximus in north-eastern India. Mammal Review 29(3): 141-173. Choudhury...

the largest living land animals. Family: Elephantidae (elephants) Genus: Elephas Asian elephant, E. maximus EN Indian elephant, E. m. indicus Sirenia is...

A.J.T.; Fernando, P.; Hedges, S.; Gunawardena, M.; Kurt, F. (2008). "Elephas maximus". IUCN Red List of Threatened Species. 2008 e.T7140A12828813. Khosravifard...

remaining forests are home to some large mammals including Asian elephants (Elephas maximus), wild water buffalo (Bubalus arnee), Eld's deer (Cervus eldii)...

Pileated gibbon (Hylobates pileatus) and the endangered wild Asian elephant (Elephas maximus). There are also sites of high biodiversity along the banks of...

Rhynchocorys elephas. According to the Plant List, 8 species are recognized in the genus Rhynchocorys: Rhynchocorys boissieri Post Rhynchocorys elephas (L.) Griseb...

86.8 Ursus maritimus Polar bear Ursidae 94 XP_040478472.1 328 77.2 82.7 Elephas maximus indicus Indian elephant Proboscidea 99 XP_049709344.1 326 79.4...

book) that the small extinct elephants of Mediterranean islands (like "Elephas melitensis", now called Palaeoloxodon melitensis) were not dwarfed elephants...

mostra personale : Museo nazionale d'Abruzzo, Castello cinquecentesco Sala Elephas - 8/31 luglio 1988 [presentazione di Cesare Vivaldi] Roma Arti grafiche...

(November 2020). "Illegal capture and internal trade of wild Asian elephants (Elephas maximus) in Sri Lanka". ResearchGate. Retrieved 25 July 2023. Kevany, Sophie...

Père David's deer, Axis shansius (ancient deer), flat-fronted elephant (Elephas planifrons), hyena, Shanxi woolly rhinoceros, Elasmotherium, Equus sanmeniensis...

identification, Blumenbach gave the woolly mammoth its first scientific name, Elephas primigenius (first-born elephant), in 1799. His reputation was much extended...

(Panthera tigris tigris), the gaur, or Indian bison, the Asiatic Elephant (Elephas maximus), several varieties of wild cats, including the fishing cat, jungle...

meles) Red panda (Ailurus fulgens fulgens) Proboscidean Asian elephant (Elephas maximus) Odd-toed ungulates Mediterranean mini donkey Grévy's zebra (Equus...

Luwian ti-pa-s 'sky; bowl, cup' (cf. Hittite nēpis 'sky; cup'); ἐλέφας, eléphās 'ivory', related to Hittite laḫpa (itself from Mesopotamia; cf. Phoenician...

Choudhury, A.U. (1999). Status and Conservation of the Asian elephant Elephas maximus in north-eastern India. Mammal Review 29(3): 141–173. Choudhury...

ancestor/ Notes Extent in the wild vs. captivity Taxon group Asian elephant (Elephas maximus) including subspecies Sri Lankan (E. m. maximus), Indian (E. m...

Hypothenemus dubitalis Bright, 2019 Hypothenemus ebenus Wood, 2007 Hypothenemus elephas (Eichhoff, 1872) Hypothenemus emmi (Hagedorn, 1913) Hypothenemus erectus...

Choudhury, A.U. (1999). "Status and conservation of the Asian elephant Elephas maximus in north-eastern India". Mammal Review. 29 (3): 141–173. Choudhury...

as endangered under CITES Appendix 1 including the Sumatran elephant (Elephas maximus) and Sumatran tiger (Panthera tigris sumatrae), two species of...

Among the faunal fossils discovered were from Stegodon sp., Elephas sp (large)., Elephas beyeri Von Koenigsvald (dwarf), Rhinoceros philippinensis, Cerpis...

which have been reported from all Reserved Forests. Asian elephants (Elephas maximus) were once widespread throughout the country with numbers as high...

Preferred habitat IUCN status Range Family Elephantidae: elephants Asian elephant Elephas maximus Linnaeus, 1758 Forest, shrubland, grassland EN IUCN...

Preferred habitat IUCN status Range Family Elephantidae: elephants Asian elephant Elephas maximus Linnaeus, 1758 Forest, shrubland, grassland EN IUCN...

damelipi Vanuatu and Viti Levu, Fiji Hunting. 800-700 BC Syrian elephant Elephas maximus asurus Mesopotamia Hunting and habitat loss due to agriculture...

play is observed in both African (Loxodonta africana) and Asian elephant (Elephas maximus) calves. It has been noted that there is an increase in male bias...

the Museums of Geology and Zoology in the University of Cambridge. I. Elephas antiquus. Proc. Camb. Phil. Soc. (Biol. Soc.), 1, no. 2, 108–120. 1925...

Retrieved 2025-06-13. Distribution map's evolution of Asian elephants (Elephas Maximus) between the beginning of 20th century (pink) and early 21st century...

Troubridge & Lafontaine, 2002 Neoligia crytora (Franclemont, 1950) Neoligia elephas Troubridge & Lafontaine, 2002 Neoligia exhausta (Smith, 1903) Neoligia...

(Neofelis nebulosa), fishing cat (Prionailurus viverrinus), Asian elephant (Elephas maximus), and pileated gibbon (Hylobates pileatus). The pileated gibbon...

sloth bear (Melursus ursinus). Large herbivores include Indian elephant (Elephas maximus indicus), gaur (Bos gaurus), sambar deer (Rusa unicolor), chital...

Sumatra, Indonesia. Species: Asian elephant (Elephas maximus) EN/en Subspecies: Sumatran elephant (Elephas maximus sumatranus) CR Species: Moonrat (Echinosorex...

diversity and disparity between wild and captive endangered Asian elephants (Elephas maximus indicus) in southern India". Antonie van Leeuwenhoek. 118 (12)...

Shoshani, J.; et al. (1982). "On the Dissection of a Female Asian Elephant (Elephas maximus maximus Linnaeus, 1758) and Data from Other Elephants". Elephant...

caquetensis Plecturocebus oenanthe Tarsius bancanus natunensis Tarsius tumpara Elephas maximus sumatranus Abrocoma boliviensis Mesocapromys nanus Mesocapromys...

d'Ivoire E African elephant Loxodonta africana Africa T Asian elephant Elephas maximus South-central and southeastern Asia E Black-footed ferret Mustela...

Faunal reports and state documentation indicate presence of Asian elephant (Elephas maximus), and jackals; the sanctuary is part of a landscape that facilitates...

3 Radio. France 3. Retrieved 15 December 2024. "Jenny, Asian elephant (Elephas maximus)". Elephant Encyclopedia. Retrieved 15 December 2024. Folprecht...

3.2 m (10 ft 6 in) Occupation Main casket bearer of the procession of Esala Known for Casket bearer Species Indian elephant (Elephas maximus indicus)...

threatened species living within the Wilpattu National Park are the elephant (Elephas maximus maximus), sloth bear (Melursus ursinus inornatus), leopard (Panthera...

are large and small herbivorous ungulates, such as the Asian elephant (Elephas maximus), Indian rhinoceros (Rhinoceros unicornis) and the wild water buffalo...

extender and cryoprotectant on the post-thaw quality of Asian elephant (Elephas maximus indicus) semen". Cryobiology. 66 (1): 52–59. doi:10.1016/j.cryobiol...

Pandey A (1994). "Pathology due to Fasciola jacksoni in Indian elephants Elephas indicus". Ind. J. Anim. Scien. 64: 802–804. Chen, M.G., Mott, K.E., 1990...

[clarification needed] in pigs infected by serogroup B, and in wild elephants (Elephas maximus). Serotypes B:1 and B:3,4 have caused septicaemic disease in antelope...

district of Labuhan Ratu, East Lampung. The number of Sumatran elephants (Elephas maximus sumatranus) living in the region has decreased. Way Kambas National...

ecoregion is home to several large mammals, including Asian elephant (Elephas maximus), gaur (Bos gaurus), Himalayan black bear (Selenarctos thibetanus)...

Choudhury, A.U. (1999). Status and Conservation of the Asian elephant Elephas maximus in north-eastern India. Mammal Review 29(3): 141–173. Choudhury...

mammoth (Mammuthus primigenius), but above all the southern elephant (Elephas meridionalis) and the Etruscan rhinoceros (Stephanorhinus etruscus), of...

mammutid was recognized as a distinct species by Robert Kerr in 1792 ("Elephas" americanus) and as the genus Mammut by Johann Friedrich Blumenbach in...

Campylomormyrus christyi Campylomormyrus curvirostris Campylomormyrus elephas Campylomormyrus mirus Campylomormyrus numenius Campylomormyrus phantasticus...

of the elephant by a speeding goods train. Gaur Golden-fronted leafbird Elephas maximus Neora Valley National Park Gorumara National Park Mahananda Wildlife...

(southern Asia) Amegilla elegans (Smith, 1859) (southern Asia) Amegilla elephas (Lieftinck, 1944) (southern Asia) Amegilla elsei Brooks, 1988 (Africa)...

Among the most interesting exhibits are the fossilized skeleton of an Elephas antiquus, the largest elephant to have lived in European forests, found...

AllMusic, retrieved June 6, 2026 Live from the Vic in Chicago - Cage the Elepha... | AllMusic, retrieved June 6, 2026 "Cage the Elephant Chart History (Canadian...

species in Leprus. These three species belong to the genus Leprus: Leprus elephas (Saussure, 1861) Leprus intermedius Saussure, 1884 — Saussure's blue-winged...

turn, the forests play host to such major fauna as the Asian elephant (Elephas maximus), Bengal tiger (Panthera tigris tigris), leopard (Panthera pardus)...

area, such as the clouded leopard (Neofelis nebulosa), Asian elephant (Elephas maximus), gaur (Bos gaurus), and banteng (Bos javanicus) as well as the...

verrucivorus, wart-biter Gryllus pupus – Hetrodes pupus Gryllus elephas – Pamphagus elephas Gryllus cristatus – Tropidacris cristata Gryllus morbillosus...

Hanako Hanako in 2006 Species Elephas maximus Sex Female Born 1947 (1947) Thailand Died May 26, 2016(2016-05-26) (aged 68–69) Inokashira Park Zoo, Musashino...

Mona (c. 1951 — June 21, 2007) was a 7,800 pound Asian elephant (Elephas maximus) on exhibit at the Birmingham Zoo in Birmingham, Alabama (United States)...

The bone fragments belonged to the following Middle Paleolithic species: Elephas sp. (compared to "Primigenius trogontherii," possibly meaning the steppe...

5. 13–24. Rowell, Z. E. (2014). Locomotion in captive Asian elephants (Elephas maximus). Journal of Zoo and Aquarium Research, 2(4), 130–135. https://doi...

each other. Due to Polybius' descriptions of Antiochus' Asian elephants (Elephas maximus), brought from India, as being larger and stronger than Ptolemy's...

Dragozaur version of Dino Sabre, armed with the Wicked Whip (Dark Whip). Drago Elephas (シャドーマンモス, Shadō Manmosu, Shadow Mammoth; 8-21) Voiced by: Ardwight Chamberlain...

Pediolophodon Tetralophodon †Stegodontidae Stegodon Stegolophodon Elephantidae Elephas Loxodonta †Mammuthus †Palaeoloxodon †Primelephas †Selenetherium †Stegodibelodon...

north-eastern India. Oryx 31(2):151–152 Choudhury, A.U. (2001) The wild elephant Elephas maximus in Mizoram. J. Bombay nat. Hist. Soc. 98(3): 439–441 "HMUIFANG...

constitutus (Bechyné, 1950) Lamprosphaerus dives (Lefèvre, 1877) Lamprosphaerus elephas (Baly, 1878) Lamprosphaerus femininus Bechyné, 1950 Lamprosphaerus femoratus...

Hart, L.A. (14 September 2000). "Seismic properties of Asian elephant (Elephas maximus) vocalizations and locomotion". J. Acoust. Soc. Am. 108 (6): 3066–3072...

elephant schistosome is a parasitic trematode that uses the Asian elephant (Elephas maximus) as a definitive host. Two other hosts may be the Indian elephant...