Search Results: Sensitivity Time Control


Case sensitivity
Minggu, 2025-08-31 13:03:30

Der englische Ausdruck case sensitivity bezeichnet in der elektronischen Datenverarbeitung allgemein die Art und Weise, in der eine Benutzerschnittstelle...

Click to read more »
Hochsensibilität
Sabtu, 2026-07-25 02:53:25

sensorischer Verarbeitungssensitivität (englisch: Sensory Processing Sensitivity SPS). Die basale Forschungstätigkeit zu dem als Persönlichkeitsdisposition...

Click to read more »
Nicht-Zöliakie-Weizensensitivität
Jumat, 2025-10-10 00:21:36

non-celiac wheat sensitivity (NCWS), synonym: Weizensensitivität, früher Nicht-Zöliakie-Glutensensitivität, englisch non-celiac gluten sensitivity (NCGS) oder...

Click to read more »
Moisture Sensitivity Level
Kamis, 2024-06-20 23:43:49

Der Moisture Sensitivity Level (MSL; deutsch „Feuchtigkeitsempfindlichkeitsschwellwert“) bezieht sich auf die Feuchteempfindlichkeit von Halbleiterbauelementen...

Click to read more »
Radar
Senin, 2026-08-10 00:21:21

werden von den Radargeräteherstellern in ihren Gerätedokumentationen Sensitivity Time Control (STC) oder Gain Time Control (GTC) genannt. Solche Schaltungen...

Click to read more »
Reinforcement Sensitivity Theorie
Sabtu, 2024-09-21 20:10:57

Die Reinforcement Sensitivity Theorie (RST) von Jeffrey Alan Gray ist eine Modifikation des Temperamentsmodells von Hans Jürgen Eysenck. Die Theorie unterteilt...

Click to read more »
C4 (Sprengstoff)
Kamis, 2026-06-18 04:38:57

Developments in Composition C-4: Towards an Alternate Binder and Reduced Sensitivity. BAE Systems OSI, abgerufen am 3. Mai 2019 (englisch).  Whitesides JD...

Click to read more »
Multiple Chemikalien-Sensitivität
Kamis, 2026-06-18 17:38:05

Chemikalienunverträglichkeit (abgekürzt MCS von englisch Multiple Chemical Sensitivity), auch idiopathische Umweltintoleranz oder idiopathische Umwelt-Unverträglichkeit...

Click to read more »
HFS Plus
Kamis, 2025-06-12 11:25:49

Kleinschreibung bei Pfad- und Dateinamen, was auch als englisch Case sensitivity bezeichnet wird. Für diese auch als HFSX bezeichnete Variante wird eine...

Click to read more »
Reitstellung
Jumat, 2026-06-12 00:30:12

PMC 28302 (freier Volltext). H. Alzate, M. L. Londono: Vaginal erotic sensitivity. In: J Sex Marital Ther. 10, 1984, S. 49–56. Karl Knörr, Henriette Knörr-Gärtner...

Click to read more »
Ext4
Jumat, 2026-04-17 00:49:00

Anzahl von Dateien per Verzeichnis erhöht (large_dir) ab Kernel 5.2: Case sensitivity kann nun optional ausgeschaltet werden (casefold) ab Kernel 5.4: Unterstützung...

Click to read more »
Ext3
Minggu, 2025-08-31 13:26:08

Dateisysteme, zwischen Groß- und Kleinschreibung unterscheidet (Case sensitivity), kann es bei der Nutzung unter Betriebssystemen welche Groß- und Kleinschreibung...

Click to read more »
Blaue Nesselqualle
Minggu, 2025-02-09 20:55:39

lamarckii. Blue jellyfish. In: Marine Life Information Network: Biology and Sensitivity Key Information Subprogramme, Plymouth: Marine Biological Association...

Click to read more »
Gonorrhoe
Senin, 2026-08-10 01:58:13

Epid. Bull. Nr. 9, März 2006 (rki.de [PDF]).  Alice Reyn: Antibiotic sensitivity of gonococcal strains isolated in the South-East Asia and Western Pacific...

Click to read more »
Klimasensitivität
Senin, 2025-12-29 16:45:13

unterschieden zwischen Gleichgewichtsklimasensitivität (Equilibrium climate sensitivity – ECS) und transienter Klimaantwort (Transient climate response – TCR)...

Click to read more »
Endorphine
Selasa, 2026-03-03 00:26:48

reduces pressure pain sensitivity in humans without involvement of beta-endorphin(1-31), but does not reduce heat pain sensitivity. In: Neuroendocrinology...

Click to read more »
Process Sensitivity Level
Jumat, 2013-11-29 01:36:28

Der Process Sensitivity Level (PSL, englisch, dt. in etwa Prozessempfindlichkeitsklasse) beschreibt die Empfindlichkeit eines elektronischen Bauelements...

Click to read more »
Gluten
Rabu, 2026-05-20 22:22:14

No Effects of Gluten in Patients With Self-Reported Non-Celiac Gluten Sensitivity After Dietary Reduction of Fermentable, Poorly Absorbed, Short-Chain...

Click to read more »
Grounded Theory
Jumat, 2026-08-07 09:34:21

Theory. 2. Auflage. Sage, London 2014. Barney G. Glaser: Theoretical Sensitivity. Advances in the Methodology of Grounded Theory. Sociology Press, Mill...

Click to read more »
Luftfeuchtigkeit
Rabu, 2026-07-08 06:26:47

Weiter­verarbeitung einer Trocknung (baking) unterzogen werden müssen, um Schäden beim Lötprozess zu vermeiden; Details unter Moisture Sensitivity Level...

Click to read more »
Coitus a tergo
Selasa, 2026-05-12 01:15:24

PMC 28302 (freier Volltext). H. Alzate, M. L. Londono: Vaginal erotic sensitivity. In: Journal of Sex & Marital Therapy. Band 10, 1984, S. 49–56. Jian...

Click to read more »
Misophonie
Selasa, 2026-03-24 00:15:55

Jastreboff geprägt. Ein häufig verwendetes Synonym ist selective sound sensitivity syndrome, auf Deutsch etwa „Selektives Geräuschempfindlichkeits-Syndrom“...

Click to read more »
Sensitivitätsanalyse
Kamis, 2025-04-17 13:10:43

Darstellung. Oldenbourg, München 1976, ISBN 3-486-34811-6 Assem Deif: Sensitivity Analysis in Linear Systems. Springer, Berlin 1986, ISBN 3-540-16312-3...

Click to read more »
Insulinresistenz
Selasa, 2026-08-11 23:47:32

M. J. Quon: Quantitative insulin sensitivity check index: a simple, accurate method for assessing insulin sensitivity in humans. In: J Clin Endocrinol...

Click to read more »
Stechmücken
Minggu, 2026-08-09 11:17:29

Allgeier, Carsten A. Brühl: Decreasing Bacillus thuringiensis israelensis sensitivity of Chironomus riparius larvae with age indicates potential environmental...

Click to read more »
Bragard-Zeichen
Sabtu, 2023-09-02 05:14:45

bei 67,42 %. Kaynoosh Homayouni, Seyedeh Halimeh Jafari, Hossein Yari: Sensitivity and Specificity of Modified Bragard Test in Patients With Lumbosacral...

Click to read more »
Agar
Sabtu, 2026-05-23 03:32:43

Scholz, Ralf Reski: Gelrite and agar differently influence cytokinin-sensitivity of a moss. In: Journal of Plant Physiology Bd. 146, 1995, S. 369–371...

Click to read more »
Lepton
Sabtu, 2026-06-13 22:01:49

Collaboration: Direct neutrino-mass measurement with sub-electronvolt sensitivity. In: Nature Physics. Band 18, Nr. 2, Februar 2022, ISSN 1745-2481, S...

Click to read more »
Bella Hadid
Senin, 2026-08-03 10:04:42

 Oktober 2025 (englisch).  Bella Hadid shocked and upset over 'lack of sensitivity' in Adidas campaign. 30. Juli 2024, abgerufen am 25. Oktober 2025 (britisches...

Click to read more »
Oxycodon
Jumat, 2026-08-07 04:32:11

Determined by Liquid Chromatography Combined With Tandem Mass Spectrometry: Sensitivity of the DRI Assay at 100 ng/ml Cut-Off and Validity of Semiquantitative...

Click to read more »
MDR1-Defekt
Sabtu, 2025-03-01 20:11:10

Rasseverteilung des MDR1-Defekts K. L. Mealey, S. A. Bentjen et al.: Ivermectin sensitivity in collies is associated with a deletion mutation of the mdr1 gene. In:...

Click to read more »
Bildsensor
Jumat, 2025-12-26 14:14:47

 587–593 (upenn.edu [PDF]).  Canon succeeds in developing world’s largest CMOS image sensor, with ultra-high sensitivity. Abgerufen am 25. Juni 2018...

Click to read more »
Exekutive Dysfunktion
Senin, 2026-05-25 00:39:14

C, Barrós A, Ortet G, Antònia Parcet M, Ibañez MI: Set-shifting and sensitivity to reward: A possible dopamine mechanism for explaining disinhibitory...

Click to read more »
SPS
Minggu, 2025-02-23 02:45:20

Paraplegiker-Stiftung Segmental progeroide Syndrome, siehe Progerie Sensory Processing Sensitivity, siehe Hochsensibilität Service de Presse Suisse, Kulturverein Sheppard...

Click to read more »
PHQ-9
Minggu, 2026-03-15 21:19:02

Gräfe: Measuring depression outcome with a brief self-report instrument: Sensitivity to change of the Patient Health Questionnaire (PHQ-9). In: J Affect Disord...

Click to read more »
Amy Madigan
Selasa, 2026-03-17 01:12:47

Lifeguard 2014: Shirin in Love 2014: Frontera 2016: Buried Child 2016: Sensitivity Training 2016: How to Get Away with Murder (Fernsehserie, Folge 3x02)...

Click to read more »
Diethyltoluamid
Kamis, 2026-03-05 20:54:58

doi:10.1073/pnas.0805312105. A natural polymorphism alters odour and DEET sensitivity in an insect odorant receptor. Nature 478, 511–514 (27. Oktober 2011);...

Click to read more »
Angstsensitivität
Kamis, 2026-06-25 16:09:09

gehören Anxiety Sensitivity Index (ASI), Anxiety Sensitivity Profile (ASP), Anxiety Sensitivity Index-Revised (ASI-R), Anxiety Sensitivity Index-3 (ASI-3)...

Click to read more »
Propan
Selasa, 2026-08-11 01:58:43

Watanabe (Japan): The Earth’s Energy Budget, Climate Feedbacks and Climate Sensitivity Supplementary Material. (PDF) In: IPCC. Abgerufen am 14. August 2024...

Click to read more »
Klima
Selasa, 2026-06-09 16:31:53

(englisch, Online [PDF]).  Richard E. Zeebe: Time-dependent climate sensitivity and the legacy of anthropogenic greenhouse gas emissions. In: PNAS. Band 110...

Click to read more »
Kennschalldruck
Selasa, 2023-03-07 16:27:44

Messbedingungen und Messverfahren für Typprüfungen" Umrechnung von Kennschalldruckpegel und Wirkungsgrad bei passiven Lautsprechern (sensitivity)...

Click to read more »
BSE Sensex
Selasa, 2026-08-11 12:57:54

Der BSE Sensex (Bombay Stock Exchange Sensitivity Index) ist der bekannteste und wichtigste Aktienindex an der Bombay Stock Exchange (BSE) in Indien....

Click to read more »
Empfindlichkeit (Technik)
Senin, 2022-04-04 23:20:43

Die Empfindlichkeit (engl. sensitivity) ist in der Messtechnik definiert als die „Änderung des Wertes der Ausgangsgröße eines Messgerätes bezogen auf...

Click to read more »
Propofol
Rabu, 2026-05-13 01:12:48

22672847. F. Vaiano, F. Mari, F. P. Busardò, E. Bertol: Enhancing the sensitivity of the LC-MS/MS detection of propofol in urine and blood by azo-coupling...

Click to read more »
Wo die wilden Kerle wohnen
Senin, 2025-11-17 08:39:52

S. 60 (englisch).  Mary Pols: Where the Wild Things Are: Sendak with Sensitivity. In: Time. Time Inc., 14. Oktober 2009, abgerufen am 14. März 2017 (englisch...

Click to read more »
Magnetresonanztomographie
Jumat, 2026-05-22 23:46:51

Acquisition Spin Echo Enhanced SE: Spin-Echo 90°–180°-Pulsfolge SENSE: Sensitivity-Encoded SMASH: Simultaneous Acquisition of Spatial Harmonics SPGR: Spoiled...

Click to read more »
Wassernesselsucht
Rabu, 2025-02-19 02:15:55

Walter B. Shelley, Howard M. Rawnsley: Aquagenic urticaria: Contact sensitivity to water. In: The Journal of the American Medical Association (JAMA)...

Click to read more »
Miniature American Shepherd
Kamis, 2026-01-29 03:55:40

und K.M. Meurs (2008): Breed distribution of the ABCB1-1Δ (multidrug sensitivity) polymorphism among dogs undergoing ABCB1 genotyping. JAVMA 233(6):921-4...

Click to read more »
Preissensivität
Senin, 2024-03-25 18:45:38

Ökonom Peter van Westendorp entwickelte 1976 ein Modell (englisch Price-Sensitivity-Meter) zur Feststellung der Zahlungsbereitschaft und Preissensitivität...

Click to read more »
Eintagsfliegen
Sabtu, 2026-07-25 12:42:51

Whiting (2003): The problem with ‘‘the Paleoptera Problem:’’ sense and sensitivity. Cladistics 19: S. 432–442. K. M. Kjer, F. L. Carle, J.Litman, J. Ware...

Click to read more »
Borderline-Persönlichkeitsstörung
Selasa, 2026-07-14 16:11:22

(Review). K. Staebler, E. Helbing, C. Rosenbach, B. Renneberg: Rejection sensitivity and borderline personality disorder. In: Clinical psychology & psychotherapy...

Click to read more »
Mississippi-Alligator
Senin, 2024-11-18 18:35:34

orientation and navigation of juvenile alligators: evidence of magnetic sensitivity. In: Journal of Comparative Physiology A. Band 154, Nr. 5, 1984, S. 649–658...

Click to read more »
Narwal
Minggu, 2026-04-12 20:09:58

Glenn: Extreme physiological adaptations as predictors of climate‐change sensitivity in the narwhal, Monodon monoceros. In: Marine Mammal Science, Band 27...

Click to read more »
Klitoris
Kamis, 2026-07-30 14:34:18

PMID 10600954, PMC 28302 (freier Volltext). Z. Hoch: Vaginal erotic sensitivity by sexological examination. In: Acta Obstetricia et Gynecologica Scandinavica...

Click to read more »
Belichtungsindex
Rabu, 2026-05-06 19:07:41

erzeugen, wird Standard-Ausgangsempfindlichkeit (englisch: standard output sensitivity (SOS)) genannt. In den Rohdaten einer fotografierten Rastergrafik werden...

Click to read more »
Letzte Kaltzeit
Senin, 2026-08-10 10:09:34

Gregory J. Hakim, Christopher J. Poulsen: Glacial cooling and climate sensitivity revisited. In: Nature. 584. Jahrgang, Nr. 7822, August 2020, ISSN 1476-4687...

Click to read more »
MSL
Senin, 2025-07-28 22:07:22

Scripting Language, Scriptsprache des IRC-Clients, siehe mIRC Moisture Sensitivity Level („Feuchtigkeitsempfindlichkeitsschwellwert“) in der Halbleitertechnik...

Click to read more »
Sisi
Sabtu, 2024-08-10 00:00:07

niederländische Getränkemarke SISI steht als Abkürzung für: Short Increment Sensitivity Index, Verfahren der subjektiven Audiometrie, siehe SISI-Test Siehe auch:...

Click to read more »
Keratitis
Sabtu, 2025-11-29 05:37:24

Héchard, Philippe Hartemann, Philippe Humeau, Marie-Cécile Trouilhé: Sensitivity of Vermamoeba (Hartmannella) vermiformis cysts to conventional disinfectants...

Click to read more »
Pädophilie
Sabtu, 2026-03-14 22:53:15

978-3-621-27614-6, S. 505–508. Kurt Freund, Robin J. Watson: Assessment of the sensitivity and specificity of a phallometric test: An update of phallometric diagnosis...

Click to read more »
Feinfühligkeit
Kamis, 2025-06-05 06:45:52

Feinfühligkeit ist ein durch Mary Ainsworth geprägter Begriff (engl. maternal sensitivity) aus der Psychologie frühkindlicher Bindungen und bezeichnet die Qualität...

Click to read more »
Ataxie
Senin, 2026-08-03 15:11:45

Grunewald, Marios Hadjivassiliou: Movement Disorders Related to Gluten Sensitivity: A Systematic Review. In: Nutrients. Band 10, Nr. 8, 8. August 2018,...

Click to read more »
Blutzucker
Senin, 2026-08-10 04:04:21

Synonyme, Übersetzungen Mark E. Daly u. a.: Acute effects on insulin sensitivity and diurnal metabolic profiles of a high-sucrose compared with a high...

Click to read more »
Klimakatastrophe
Senin, 2026-03-30 03:44:22

nature.com pik-potsdam.de (PDF; 515 kB) James Hansen u. a.: Climate sensitivity, sea level and atmospheric carbon dioxide. In: Royal Society Publishing...

Click to read more »
Asperger-Syndrom
Selasa, 2026-08-11 14:47:36

Kingsley Publishers, London 2007, ISBN 978-1-84642-559-2, 11. Sensory Sensitivity, S. 271 ff.  Mandy Roy et al.: Das Asperger-Syndrom im Erwachsenenalter...

Click to read more »
Barney G. Glaser
Senin, 2024-10-07 02:32:51

Grounded-Theory-Methodologien. Darüber veröffentlichte er Theoretical Sensitivity (1978) und mehrere weitere Methodologien und Sammelbände zur Grounded...

Click to read more »
Essig
Jumat, 2026-07-17 19:39:39

Stability of SARS coronavirus in human specimens and environment and its sensitivity to heating and UV irradiation. Biomed Environ Sci. September 2003;16(3):...

Click to read more »
Klimawandel
Kamis, 2026-07-16 22:51:47

Hutchinson, Richard D. Pancost: Global mean surface temperature and climate sensitivity of the early Eocene Climatic Optimum (EECO), Paleocene–Eocene Thermal...

Click to read more »
Morbus Cushing
Selasa, 2026-07-21 07:29:52

Riebold et al.: A C-terminal HSP90 inhibitor restores glucocorticoid sensitivity and relieves a mouse allograft model of Cushing disease. In: Nature Medicine...

Click to read more »
John Schlesinger
Selasa, 2025-09-16 20:09:33

Camerimage 1996: Special Award Film Direction with a Special Visual Sensitivity Cinequest San Jose Film Festival 1998: Maverick Tribute Award David di...

Click to read more »
Liste medizinischer Abkürzungen
Selasa, 2026-08-11 00:41:34

Hereditäre Autosomal-rezessive primäre Mikrozephalie MCS Multiple Chemical Sensitivity Vielfache Chemikalienunverträglichkeit MCS Minimally conscious state...

Click to read more »
Gammastrahlung
Rabu, 2026-06-24 14:12:27

MAGIC Telescopes La Palma, Gamma-ray astronomy at low energies with high sensitivity Informationsschreiben der BG RCI (Memento vom 2. April 2015 im Internet...

Click to read more »
Triazole
Selasa, 2025-11-18 14:44:00

changes in the target P450 CYP51 enzyme associated with altered triazole-sensitivity in fungal pathogens of cereal crops. International Symposium on Cytochrome...

Click to read more »
Dinkel
Kamis, 2026-08-06 00:26:14

between Wheat and Spelt Bread in Patients with Suspected Non-Celiac Wheat Sensitivity. In: Nutrients. Band 14, Nr. 14, 7. Juli 2022, S. 2800, doi:10.3390/nu14142800...

Click to read more »
Global Positioning System
Jumat, 2026-08-07 01:05:20

Accelerating changes in ice mass within Greenland, and the ice sheet’s sensitivity to atmospheric forcing. In: Proceedings of the National Academy of Sciences...

Click to read more »
Julia Monro
Sabtu, 2026-08-01 18:52:42

verschiedenen medialen Kontexten tätig und begleitet regelmäßig Produktionen mit Sensitivity Reading. Sie war maßgeblich an der inhaltlichen Beratung für den Film...

Click to read more »
Haferflocken
Jumat, 2026-04-17 02:30:15

Li, Y. (2014). Effect of oat intake on glycaemic control and insulin sensitivity: A meta-analysis of randomised controlled trials. British Journal of...

Click to read more »
John MacFarlane
Selasa, 2025-03-11 20:20:49

Assessment sensitivity (unveröffentlicht): S. 78, online (PDF; 1,2 MB). Assessment sinsitivity (unveröffentlicht): S. 35–37. Assessment sensitivity (unveröffentlicht):...

Click to read more »
Übertragungsfaktor
Jumat, 2025-09-05 06:20:48

Übertragungsfaktor z. T. nicht in der SI-Einheit mV/Pa angegeben, sondern als sensitivity in dB bzw. in V o l t d y n / c m 2 , {\displaystyle \mathrm {\frac {Volt}{dyn/cm^{2}}}...

Click to read more »
Sony Alpha 7S
Kamis, 2026-01-29 21:29:20

April 2014 im Handel erhältlich ist. Die Bezeichnung S steht dabei für sensitivity, also die höhere Lichtempfindlichkeit des Sensors unter Verzicht auf...

Click to read more »
Octafluornaphthalin
Minggu, 2026-01-25 02:59:49

doi:10.1002/ejoc.200300570. Alexander B. Fialkov, Urs Steiner u. a.: Sensitivity and noise in GC–MS: Achieving low limits of detection for difficult analytes...

Click to read more »
Ketamin
Kamis, 2026-08-06 22:19:06

SM, Erreger K, Yuan H et al.: Subunit-specific mechanisms and proton sensitivity of NMDA receptor channel block. In: J Physiol. 581. Jahrgang, Pt 1, 2007...

Click to read more »
Denatoniumbenzoat
Jumat, 2026-04-24 16:25:30

Abgerufen am 8. April 2025 (deutsch).  Matthew Gibbs u. a.: Bitter taste sensitivity in domestic dogs (Canis familiaris) and its relevance to bitter deterrents...

Click to read more »
Training
Senin, 2026-06-15 16:02:44

gruppendynamisches Laboratorium, Encounter-Gruppe, Gruppenpsychotherapie, Sensitivity Training); siehe auch National Training Laboratory (NTL). Das Jugendgerichtsgesetz...

Click to read more »
Ovarialkarzinom
Senin, 2025-11-10 00:37:21

Mucinous advanced epithelial ovarian carcinoma: clinical presentation and sensitivity to platinum-paclitaxel-based chemotherapy, the GINECO experience. In:...

Click to read more »
Sony Alpha 7S II
Jumat, 2026-01-30 04:20:34

klein. Die Bezeichnung S bezieht sich auf die höhere Empfindlichkeit (=sensitivity) der Kamerasensoren unter Verzicht auf höhere Auflösung. Diese Kamera...

Click to read more »
Liste von Erdbeben auf Zypern
Jumat, 2025-05-30 20:34:03

 785–786 (google.com [abgerufen am 28. März 2023]).  S. Yolsal, T. Taymaz: Sensitivity Analysis on Relations Between Earthquake Source Rupture Parameters and...

Click to read more »
Kreatin
Rabu, 2026-08-12 19:15:07

Phosphocreatine Circuit: Molecular and Cellular Physiology of Creatine Kinases, Sensitivity to Free Radicals, and Enhancement by Creatine Supplementation. In: Molecular...

Click to read more »
Paranormal
Kamis, 2025-09-25 14:58:40

Schofield, Ian S. Baker: Dissociative tendencies, sensory processing sensitivity and aberrant salience as predictors of anomalous experiences and paranormal...

Click to read more »
Schleifenquantengravitation
Sabtu, 2026-02-21 18:48:01

Cosmological Constant in LQG Vertex Amplitude G. Amelino-Camelia, Potential Sensitivity of Gamma-Ray Burster Observations to Wave Dispersion in Vacuo G. Amelino-Camelia...

Click to read more »
Reint E. Gropp
Kamis, 2026-04-16 16:52:32

Gropp: Spillover Effects among Financial Institutions: A State-Dependent Sensitivity Value-at-Risk Approach. In: Journal of Financial and Quantitative Analysis...

Click to read more »
Paläozän/Eozän-Temperaturmaximum
Sabtu, 2026-06-27 01:34:11

Hutchinson, Richard D. Pancost: Global mean surface temperature and climate sensitivity of the early Eocene Climatic Optimum (EECO), Paleocene–Eocene Thermal...

Click to read more »
McNab
Minggu, 2025-05-11 17:51:53

(Multidrug Sensitivity) und somit des MDR1-Defekts. K.L. Mealey und K.M. Meurs (2008): Breed distribution of the ABCB1-1Δ (multidrug sensitivity) polymorphism...

Click to read more »
Bitterschokolade
Kamis, 2026-08-06 15:38:42

administration of dark chocolate is followed by a significant increase in insulin sensitivity and a decrease in blood pressure in healthy persons. In: American Journal...

Click to read more »
Fluide und kristalline Intelligenz
Rabu, 2026-02-25 19:48:13

Strassberg: Validation of the Behavioral Dyscontrol Scale-Electronic Version: Sensitivity to subtle sequelae of mild traumatic brain injury. In: Brain Injury....

Click to read more »
Katzenjunges
Rabu, 2026-02-25 00:42:05

Michael J. Friedlander: Postnatal development of the spatial contrast sensitivity of X- and Y-cells in the kitten retinogeniculate pathway. In: Journal...

Click to read more »
Schmerzschwelle
Senin, 2024-05-06 09:50:12

Schmerzschwelle erfassen. Martin S. Angst, Nicholas G. Phillips u. a.: Pain sensitivity and opioid analgesia. A pharmacogenomic twin study. In: Pain, Band 153...

Click to read more »
Kipptisch als Prüfverfahren
Rabu, 2026-08-05 13:46:37

heart rate variability, blood pressure variability and baroreceptor sensitivity during rest and head-up tilt. In: Blood Pressure Monitoring. Band 10...

Click to read more »
Ohr
Kamis, 2026-02-26 05:09:06

(digitale-sammlungen.de).  T. Aran Mooney et al.: Potential for Sound Sensitivity in Cephalopods. In: Arthur Popper, Anthony Hawkins (Hrsg.): The Effects...

Click to read more »
Pornografiekonsum von Jugendlichen
Kamis, 2026-07-23 20:12:49

Jonathan J. Wisco: The components of the adolescent brain and its unique sensitivity to sexually explicit material. In: Journal of Adolescence. Band 72, April...

Click to read more »
Warmklima
Kamis, 2026-03-26 00:47:47

0812721106 (englisch, pnas.org).  Richard E. Zeebe: Time-dependent climate sensitivity and the legacy of anthropogenic greenhouse gas emissions. In: pnas. 110...

Click to read more »
Vulnerabilität
Kamis, 2026-04-09 18:23:11

Verwundbarkeit als eine Funktion von Exposition (exposure), Sensitivität (sensitivity) und Anpassungsfähigkeit (adaptive capacity) verstanden: Exposition umfasst...

Click to read more »
Oktanzahl
Sabtu, 2026-04-18 13:57:30

Oktanzahl. Die Differenz zwischen ROZ und MOZ wird als „Empfindlichkeit“ (sensitivity) bezeichnet und bringt die Temperaturabhängigkeit der Oktanzahl zum Ausdruck...

Click to read more »
Formaldehyd
Rabu, 2026-04-15 05:08:01

D. J. Luecken, S. L. Napelenok, M. Strum, R. Scheffe, S. Phillips: Sensitivity of Ambient Atmospheric Formaldehyde and Ozone to Precursor Species and...

Click to read more »
Volatilität
Jumat, 2025-12-05 20:14:25

Schoelkopf, Nikoleta Tushteva: Long-Term Volatility Shapes the Stock Market's Sensitivity to News. In: Journal of Econometrics. 2023, ISSN 1556-5068, doi:10.1016/j...

Click to read more »
Dateiname
Rabu, 2026-06-03 22:21:18

veränderte Groß- und Kleinschreibung keinen Unterschied macht (keine case sensitivity). Die optionale Dateinamenserweiterung ist Teil des Dateinamens. Ein...

Click to read more »
Chinazolin
Sabtu, 2026-01-24 06:18:07

Yun: Structural and mechanistic underpinnings of the differential drug sensitivity of EGFR mutations in non-small cell lung cancer. In: Biochimica et Biophysica...

Click to read more »
Ungeschminkt (Film)
Kamis, 2026-03-05 03:48:18

von Dirk Kummer nach einem Drehbuch von Uli Brée vor der Kamera. Als Sensitivity-Beraterin fungierte Julia Monro. Premiere war am 5. Juli 2024 am Filmfest...

Click to read more »
Lichtgeschwindigkeit
Rabu, 2026-06-17 21:26:08

John Ellis, N. E. Mavromatos, D. V. Nanopoulos, Subir Sarkar: Potential Sensitivity of Gamma-Ray Burster Observations to Wave Dispersion in Vacuo. In: Nature...

Click to read more »
Nonverbale Kommunikation
Senin, 2026-06-15 19:35:07

Hall (1979): A cross-national study of gender differences in nonverbal sensitivity. Unveröffentlichtes Manuskript, Northeastern University, Boston (Massachusetts)...

Click to read more »
Aufmerksamkeitsdefizit-/Hyperaktivitätsstörung
Sabtu, 2026-07-18 21:44:14

16. Oktober 2015.  N. Grizenko, R. M. Rodrigues Pereira, R. Joober: Sensitivity of scales to evaluate change in symptomatology with psychostimulants...

Click to read more »
STC
Senin, 2021-07-12 18:59:21

saudi-arabisches Telekommunikationsunternehmen Schenefelder TC, einen Tennisclub Sensitivity Time Control, eine Radarbaugruppe Short Time Constant, eine weitere Radarbaugruppe...

Click to read more »
Zerebrale Amyloidangiopathie
Selasa, 2026-02-03 22:19:58

Greenberg, J. P. Vonsattel: Diagnosis of cerebral amyloid angiopathy. Sensitivity and specificity of cortical biopsy. In: Stroke. 1997 Jul;28(7), S. 1418–1422...

Click to read more »
Chemotherapie
Minggu, 2026-02-22 16:33:22

H. Goldie, A. J. Coldman: A mathematic model for relating the drug sensitivity of tumors to their spontaneous mutation rate. In: Cancer Treat Rep. 63...

Click to read more »
Dysurie
Jumat, 2026-07-10 03:40:30

Urinary House Soiling (Periuria) in Cats and Its Differentiation: The Sensitivity and Specificity of Common Diagnostic Signs. In: Front Vet Sci 5, 2018...

Click to read more »
Prompt-Engineering
Rabu, 2026-07-15 16:17:23

leicht veränderten Formulierungen kann die Prompt-Sensitivity getestet werden. Bei hoher Prompt-Sensitivity sind die Resultate fraglich. Als Reflexion-Prompting...

Click to read more »
Empathie
Minggu, 2026-08-09 03:45:13

2018 im Internet Archive)). J. A. Hall, F. J. Bernieri: Interpersonal Sensitivity, Theory and Measurement. London 2001, S. 21 f. und Paul Ekman: Gefühle...

Click to read more »
Thees Uhlmann
Minggu, 2026-07-05 23:39:56

2006, ISBN 3-89602-697-6. Maren Volkmann: ‚Heulsusen-pop‘. New Male sensitivity in German independent music. In: Michael Ahlers, Christoph Jacke (Hrsg...

Click to read more »
Diabetes mellitus
Senin, 2026-05-18 17:31:51

S. 222–260, hier S. 240–241. Mark E. Daly: Acute effects on insulin sensitivity and diurnal metabolic profiles of a high-sucrose compared with a high...

Click to read more »
ECS
Jumat, 2024-02-09 02:44:30

Cushing-Syndrom, eine Pferdekrankheit Klimasensitivität (Equilibrium Climate Sensitivity, Gleichgewichts-Klimasensitivität) Erlangen Classification System, System...

Click to read more »
Andreas Schmittner
Senin, 2026-04-20 01:41:05

Nature Schmittner u. a. 2011, J. Climate Schmittner u. a.: Climate Sensitivity Estimated from Temperature Reconstructions of the Last Glacial Maximum...

Click to read more »
Das Leben des Brian
Rabu, 2026-05-06 22:38:22

Against, S 79. “[…] a disgraceful and distasteful assault on religious sensitivity.” Robert E. A. Lee, zitiert in Hewison, Monty Python: The Case Against...

Click to read more »
Filmempfindlichkeit
Rabu, 2026-03-18 18:17:58

jeweils mit einem Empfindlichkeitsleitwert Sv (englisch speed value / sensitivity) in Belichtungsstufen gemäß dem APEX-System. Der Standard der Internationalen...

Click to read more »
E-Mail-Adresse
Kamis, 2025-06-26 12:35:54

zwischen Groß- und Kleinschreibung unterschieden wird (englisch Case sensitivity), ist abhängig von der Interpretation durch die Domain des Empfängers...

Click to read more »
Objektpermanenz
Rabu, 2025-03-26 00:15:29

Topal, G. Gergely, A. Erdohegyi, G. Csibra, A. Miklosi: Differential Sensitivity to Human Communication in Dogs, Wolves, and Human Infants. In: Science...

Click to read more »
Oberammergauer Passionsspiele
Rabu, 2026-01-28 21:42:23

Die Deutsche Bühne, Heft Nr. 7/2000 (PDF; 589 kB) David Briggs: Out of sensitivity to Jews, changes made in Passion play, but 'blood curse' remains Tampa...

Click to read more »
Cannabis als Rauschmittel
Senin, 2026-06-15 13:19:55

studies examining the effects of cannabis use on motivation and reward sensitivity have yielded mixed findings. We conclude that cross-sectional evidence...

Click to read more »
Golfstrom
Minggu, 2026-06-14 20:34:10

general circulation model and application to Atlantic heat transport sensitivity. In: Journal of Geophysical Research 104 (1999), S. 29529-29547. DOI:...

Click to read more »
Kollektivismus
Senin, 2026-07-27 02:46:02

Nisbett: Attending holistically versus analytically: comparing the context sensitivity of Japanese and Americans. In: Journal of Personality and Social Psychology...

Click to read more »
Malaienbär
Senin, 2026-06-08 17:32:04

Taylor: Facial Complexity in Sun Bears: Exact Facial Mimicry and Social Sensitivity. In: Scientific Reports. Band 9, Nr. 1, 21. März 2019, ISSN 2045-2322...

Click to read more »
Zöliakie
Senin, 2026-07-27 23:29:25

Redefining the intraepithelial lymphocytes threshold to diagnose gluten sensitivity in patients with architecturally normal duodenal histology: Mild enteropathy...

Click to read more »
Fettschwalm
Jumat, 2026-01-09 20:43:07

The eyes of oilbirds (Steatornis caripensis): pushing at the limits of sensitivity. In: Naturwissenschaften. Band 91, Nr. 1, 2004, S. 26–29, doi:10.1007/s00114-003-0495-3...

Click to read more »
Rebecca Bondü
Selasa, 2024-01-09 00:18:13

Bilgin, R. Bondü, B. Elsner: Longitudinal associations between justice sensitivity, nonsuicidal self-injury, substance use, and victimization by peers....

Click to read more »
Menschliche Geschlechtsunterschiede
Sabtu, 2026-07-25 12:38:42

Lars Moller: mprisonment and women’s health: concerns about gender sensitivity, human rights and public health. In: Bulletin of the World Health Organization...

Click to read more »
Katharina Seck
Rabu, 2026-07-15 17:03:20

Phantastik-Literaturpreis Seraph ausgezeichnet. Katharina Seck ist außerdem als Sensitivity Readerin tätig und setzt sich aktiv für Gleichberechtigung, Inklusion...

Click to read more »
Nocebo-Effekt
Jumat, 2026-08-07 17:26:59

u. a.: A double-blind study of symptom provocation to determine food sensitivity. In: NEJM 323, 1990, S. 429–433. PMID 2374564. G. Liccardi u. a.: Evaluation...

Click to read more »
Silken Windhound
Jumat, 2026-04-17 20:36:45

KM. Meurs (2008): Breed distribution of the ABCB1-1Delta (multidrug sensitivity) polymorphism among dogs undergoing ABCB1 genotyping. In: JAVMA 233(6):921-4...

Click to read more »
Hausstaubmilben
Senin, 2025-12-22 15:20:46

Biagtan, R. Viswanathan, R. K. Bush: Immunotherapy for house dust mite sensitivity: where are the knowledge gaps? In: Current allergy and asthma reports...

Click to read more »
Sehschärfe
Kamis, 2026-08-06 14:49:49

Sabel: Assessing spatial vision – automated measurement of the contrast-sensitivity function in the hooded rat. In: Journal of Neuroscience Methods. Band 97...

Click to read more »
Kurt Lewin
Kamis, 2026-05-07 09:06:46

das Sensitivitätstraining oder die T(rainings)-Gruppe (engl. auch als sensitivity training group bezeichnet), die ein Grundmodell jeder Selbsthilfegruppe...

Click to read more »
Narzisstische Persönlichkeitsstörung
Rabu, 2026-08-05 14:57:28

76, Heft 4, 2008, S. 753–774; G. D. Atlas, M. A. Them: Narcissism and sensitivity to criticism: A preliminary investigation. In: Current Psychology. Band...

Click to read more »
Pinatubo
Minggu, 2026-06-21 04:37:08

5194/acp-13-11221-2013. Tilmes, S., Müller, R., & Salawitch, R. (2008). The sensitivity of polar ozone depletion to proposed geoengineering schemes. Science...

Click to read more »
Weibliche Genitalverstümmelung
Sabtu, 2026-06-27 16:58:09

nach England, wo FGM zwar seit 1985 verboten ist, die Toleranz („ethnic sensitivity“) gegenüber dieser archaischen Tradition jedoch als größer eingeschätzt...

Click to read more »
Periurie
Selasa, 2024-06-25 12:43:35

Urinary House Soiling (Periuria) in Cats and Its Differentiation: The Sensitivity and Specificity of Common Diagnostic Signs. In: Front Vet Sci 5, 2018...

Click to read more »
Liste von Erdbeben
Selasa, 2026-07-28 20:31:55

Data Center, Boulder (Colorado) (englisch) Seda Yolsal, Tuncay Taymaz: Sensitivity Analysis on Relations Between Earthquake Source Rupture Parameters and...

Click to read more »
Panikstörung
Kamis, 2026-07-23 16:38:56

autofahrenohneangst.com N. B. Schmidt, M. J. Zvolensky, Maner JK: Anxiety sensitivity: Prospective prediction of panic attacks and Axis I pathology. In: Journal...

Click to read more »
Känozoikum
Sabtu, 2026-06-27 01:30:32

Hutchinson, Richard D. Pancost: Global mean surface temperature and climate sensitivity of the early Eocene Climatic Optimum (EECO), Paleocene–Eocene Thermal...

Click to read more »
Basis Point Value
Minggu, 2026-04-26 02:20:03

Gabler Banklexikon. Springer Gabler, abgerufen am 25. April 2026.  Price Sensitivity (Basis Point Value). (PDF; 462 KB) ICE Futures Europe, 2014, abgerufen...

Click to read more »
Pascal (Programmiersprache)
Selasa, 2026-07-14 15:16:49

vereinigt. In C dürfen Funktionen nicht verschachtelt definiert werden. Case sensitivity Im Gegensatz zu C ist Pascal in Bezug auf Schlüsselwörter, Bezeichner...

Click to read more »
Mikrowellenherd
Sabtu, 2026-07-11 02:44:17

Abgerufen im 1. Januar 1  H. A. Kues, J. C. Monahan et al.: Increased sensitivity of the non-human primate eye to microwave radiation following ophthalmic...

Click to read more »
Zirkumzision
Jumat, 2026-08-07 00:47:12

T'Sjoen, R. Vlietinck, P. B. Hoebeke: Male circumcision decreases penile sensitivity as measured in a large cohort. In: BJU international. Band 111, Nummer...

Click to read more »
Silibinin
Kamis, 2026-06-11 00:04:54

Riebold et al.: A C-terminal HSP90 inhibitor restores glucocorticoid sensitivity and relieves a mouse allograft model of Cushing disease. In: Nature Medicine...

Click to read more »
SARS-CoV-2
Senin, 2026-08-10 18:51:29

Heinrich Scheiblauer, Angela Filomena, Andreas Nitsche et al.: Comparative sensitivity evaluation for 122 CE-marked rapid diagnostic tests for SARS-CoV-2 antigen...

Click to read more »
Liposarkom
Minggu, 2025-12-14 00:37:44

31, 2007, S. 1476–1489. PMID 17895748 R. L. Jones u. a.: Differential sensitivity of liposarcoma subtypes to chemotherapy. In: European Journal of Cancer...

Click to read more »
Eiszeitalter
Senin, 2026-07-20 19:24:59

abgerufen am 30. Oktober 2022]).  Richard E. Zeebe: Time-dependent climate sensitivity and the legacy of anthropogenic greenhouse gas emissions. In: PNAS. 110...

Click to read more »
Dispositionsindex
Minggu, 2026-05-10 14:04:46

controlling glucose tolerance in man: measurement of insulin sensitivity and beta-cell glucose sensitivity from the response to intravenous glucose. In: The Journal...

Click to read more »
Seemaus
Jumat, 2026-04-17 20:28:02

Aphrodita aculeata. Sea mouse. Marine Life Information Network: Biology and Sensitivity Key Information Sub-programme, Plymouth: Marine Biological Association...

Click to read more »
Narbe (Botanik)
Jumat, 2026-05-29 14:53:27

S. 69. Xiao-Fang Jin, Zhong-Ming Ye, Grace M. Amboka et al.: Stigma Sensitivity and the Duration of Temporary Closure Are Affected by Pollinator Identity...

Click to read more »
Septin-9-Test
Kamis, 2026-05-07 18:26:50

Rahmani, JH. Haseman, GT. Lemmel, S. Kaster, JS. Buckley: Relative sensitivity of colonoscopy and barium enema for detection of colorectal cancer in...

Click to read more »
Grottenolm
Jumat, 2026-07-17 17:59:00

other cave-dwelling urodele species). Review and new results on light-sensitivity and non-visual orientation in subterranean urodeles (Amphibia). In: Animal...

Click to read more »
Pestalotiopsis microspora
Sabtu, 2025-07-19 10:27:20

 November 2020.  C.Q. Zhang, Y.H. Liu, H.M. Wu, B.C. Xu, P.L. Sun: Baseline sensitivity of Pestalotiopsis microspora, which causes black spot disease on Chinese...

Click to read more »
Stickstoffmonoxid
Senin, 2026-07-27 01:08:01

supplementation improves endothelial function and ameliorates insulin sensitivity and inflammation in cardiopathic nondiabetic patients after an aortocoronary...

Click to read more »
Liebe und Anarchie (Fernsehserie)
Sabtu, 2025-12-27 18:50:05

Publishing Jägerstedt Publishing Lisa Langseth Alex Haridi 11 3 Der Sensitivity Consultant Sensitivitetskonsulten Lisa Langseth Maria Nygren 12 4 Literatur...

Click to read more »
Perfektionismus (Psychologie)
Jumat, 2026-05-29 13:33:41

Orientations in Depression: an analysis of Validation seeking and rejection sensitivity in a Community sample of Young adults. 2014, PMID 24575914.  Smith et...

Click to read more »
Beck-Depressions-Inventar
Selasa, 2025-09-23 00:24:51

M. Kojima, I. Yamamoto et al.: Gradations of clinical severity and sensitivity to change assessed with the Beck Depression Inventory-II in Japanese...

Click to read more »
Logarithmische Normalverteilung
Minggu, 2025-01-26 16:26:46

PMID 29071065, PMC 5639933 (freier Volltext).  R A Romero, T B Sutton: Sensitivity of Mycosphaerella fijiensis, causal agent of black sigatoka of banana...

Click to read more »
Western Blot
Kamis, 2026-05-28 00:01:33

PMID 20206115. Fabrizio Gentile, Ernesto Bali, Giuseppe Pignalosa: Sensitivity and applications of the nondenaturing staining of proteins on polyvinylidene...

Click to read more »
Intraokularlinse
Senin, 2026-01-05 01:27:53

providing monofocal-like distance visual quality or provide contrast sensitivity that is significantly poorer than with monofocal IOLs.“  Joaquín Fernández...

Click to read more »
Angela Merkel
Senin, 2026-07-20 01:51:25

Spangenberg, T. Turanyi (1982): An Extended Kinetic Model and its Reduction by Sensitivity Analysis for the Methanol//Oxygen Gas-Phase Thermolysis. In: Acta Chimica...

Click to read more »
Ozark-Plateau
Jumat, 2026-01-23 17:32:57

Habitats in the Ozark Highlands of Missouri: Assessment of Physical Habitat Sensitivity to Environmental Change. United States Geological Survey – Biological...

Click to read more »
Selbsterfahrung
Kamis, 2025-02-20 05:51:15

Gruppendynamischen Trainings auf der Selbsterfahrung, spricht man von Sensitivity-Training, wo es verstärkt um Gespür, Feinfühligkeit, Einfühlungs- und...

Click to read more »
Recruitment
Jumat, 2026-06-26 18:34:27

Beispiele sind der Fowler-Test, der Lüscher-Test und der Short Increment Sensitivity Index (SISI-Test). Diese Tests haben durch Hirnstammaudiometrie (FAP...

Click to read more »
Insulin
Selasa, 2026-07-14 14:10:53

S. 4–10, hier: S. 4 und 7–8. Mark E Daly: Acute effects on insulin sensitivity and diurnal metabolic profiles of a high-sucrose compared with a high...

Click to read more »
Weltraummüll
Minggu, 2026-07-12 17:10:18

am 26. Februar 2021 (englisch).  J.-C. Liou, Nicholas L. Johnson: A sensitivity study of the effectiveness of active debris removal in LEO. In: Acta...

Click to read more »
Uğur Şahin
Jumat, 2026-07-17 02:57:42

2020]).  Prof. Dr. med. Ugur Sahin. In: SFB 1399: Mechanisms of Drug Sensitivity and Resistance in Small Cell Lung Cancer. Department of Translational...

Click to read more »
Mondrückseite
Sabtu, 2026-04-11 16:07:16

frequency interference-free dedicated lunar far side crater for high sensitivity radioastronomy. Acta Astronautica, Vol. 46, Issue 8, 1. April 2000, S...

Click to read more »
Verlustaversion
Selasa, 2026-06-02 15:13:27

bildet das Prinzip der abnehmenden Sensitivität (englisch diminishing sensitivity) ab. Da die Wertfunktion im Verlustbereich steiler als im Gewinnbereich...

Click to read more »
Tetrahydrocannabinol
Jumat, 2026-05-15 14:52:31

15;852:158457, PMID 36063955. Sandra B. Grauwiler, Jürgen Drewe, André Scholer: Sensitivity and Specificity of Urinary Cannabinoid Detection with Two Immunoassays...

Click to read more »
Schweigestrafe
Selasa, 2026-07-28 00:33:33

Clarkin: A Multisurface Interpersonal Circumplex Assessment of Rejection Sensitivity. In: Journal of Personality Assessment. 99. Jahrgang, Nr. 1, 2. Januar...

Click to read more »
Wüstengoldmull
Rabu, 2024-07-31 22:13:28

(2), 2006, S. 1260–1268 Matthew J. Mason und Peter M. Narins: Seismic sensitivity in the Desert golden mole (Eremitalpa granti): A review. Journal of Comparative...

Click to read more »
Titan(IV)-oxid
Minggu, 2026-07-26 19:34:52

Ralf Schulz, Elena A. Rozhkova: Titanium Dioxide Nanoparticles Increase Sensitivity in the Next Generation of the Water Flea Daphnia magna. In: PLoS ONE...

Click to read more »
Elizabeth (Film)
Senin, 2026-04-27 19:15:34

[…] Kapur’s direction has a lavish, sinister energy, tempered by a sensitivity to the potential silliness of a film which puts a legion of British character...

Click to read more »
Silken Windsprite
Jumat, 2026-04-17 20:36:46

KM. Meurs (2008): Breed distribution of the ABCB1-1Delta (multidrug sensitivity) polymorphism among dogs undergoing ABCB1 genotyping. In: JAVMA 233(6):921-4...

Click to read more »
Glyphosat
Rabu, 2026-07-01 02:47:38

eja.2009.06.004.  Tuomas Tall, Pere Puigbò: Rethinking the Intrinsic Sensitivity of Fungi to Glyphosate. In: Biotech (Basel (Switzerland)). Band 11, Nr...

Click to read more »
Elaine Aron
Kamis, 2024-07-25 22:18:23

heute als Pionierin gilt, und prägte den Begriff Sensory Processing Sensitivity (SPS). Nach einer Operation 1987, die sie emotional aufwühlte, wurde...

Click to read more »
Sony Alpha 7S III
Kamis, 2026-01-29 22:17:22

klein. Die Bezeichnung S bezieht sich auf die höhere Empfindlichkeit (sensitivity) der Kamerasensoren unter Verzicht auf höhere Auflösung. Diese Kamera...

Click to read more »
Kultivierung
Selasa, 2026-07-14 15:34:05

Scholz, Ralf Reski: Gelrite and agar differently influence cytokinin-sensitivity of a moss. In: Journal of Plant Physiology. Bd. 146, 1995, S. 369–371...

Click to read more »
Schwefel
Senin, 2026-07-20 20:00:54

Internet Archive)  Tilmes, S., Müller, R., & Salawitch, R. (2008). The sensitivity of polar ozone depletion to proposed geoengineering schemes. Science...

Click to read more »
Aldehyd-Dehydrogenasen
Minggu, 2024-07-28 21:30:25

pyridoxin-dependent. In: Online Mendelian Inheritance in Man. (englisch). Alcohol sensitivity. In: Online Mendelian Inheritance in Man. (englisch)....

Click to read more »
Gottkomplex
Rabu, 2026-04-22 14:41:49

 123 (englisch, google.com).  Kaplan, Harold I.; Benjamin J. Sadock: Sensitivity through encounter and marathon. In: Modern Group Book. Band 4. J. Aronson...

Click to read more »
Lautsprecher
Selasa, 2026-08-11 19:54:00

Unterscheidet Kennschalldruckpegel und Wirkungsgrad bei passiven Lautsprechern (sensitivity & efficiency) Visaton SC 5 Fostex FW800HS SMSG50 von Ascendo mit Sitz...

Click to read more »
Michael Bevis
Sabtu, 2024-08-24 18:27:53

Accelerating changes in ice mass within Greenland, and the ice sheet’s sensitivity to atmospheric forcing. Proceedings of the National Academy of Sciences...

Click to read more »
Matlab
Selasa, 2026-06-02 15:35:21

Arrays. MathWorks, abgerufen am 3. Mai 2026 (englisch).  Case and Space Sensitivity. MathWorks, archiviert vom Original (nicht mehr online verfügbar) am...

Click to read more »
Geräuschpegelabstand
Jumat, 2020-04-24 01:59:27

3-910098-19-3 Systeme der Audiosignalverarbeitung (PDF; 4,48 MB) Mikrofonpegel und ihre Bezugswerte (PDF; 200 kB) Mikrofon-Empfindlichkeit (sensitivity)...

Click to read more »
Dingo
Selasa, 2026-05-05 16:35:19

2001, S. 76, doi:10.1046/j.1365-2664.2001.00569.x. J. C. McIlroy: The Sensitivity of Australian Animals to 1080 Poison 11. Marsupial and Eutherian Carnivores...

Click to read more »
Dan Cacuci
Minggu, 2026-05-10 05:05:30

an der Columbia University). doi:10.2172/12131479 Sensitivity and Uncertainty Analysis Sensitivity and Uncertainty Analysis. Volume 1: Theory. Chapman...

Click to read more »
Vogelzug
Senin, 2026-07-13 03:06:16

Church, Julian C. Partridge: Behavioural investigation of polarisation sensitivity in the Japanese quail (Coturnix coturnix japonica) and the European starling...

Click to read more »
Getränkedose
Senin, 2026-08-10 11:36:20

84 % der Limonaden und Cola in Dosen mit Bisphenol A belastet. Chemical Sensitivity Network, 6. März 2009, abgerufen am 17. September 2013.  Carsten Dierig:...

Click to read more »
The Shapeshifters
Senin, 2026-04-20 20:34:56

Incredible (Nocturnal Groove) 2006: If In Doubt Go Out (Positiva) 2006: Sensitivity feat. Chic (Positiva) 2007: Pusher (Positiva) 2007: New Day (Positiva)...

Click to read more »
Gruppendynamik
Senin, 2026-01-26 20:21:57

des gruppendynamischen Trainings ist die T-Gruppe (im engl. auch als sensitivity training group bezeichnet). In der T-Gruppe arbeiten 7–15 Teilnehmer...

Click to read more »
Kokosöl
Jumat, 2026-02-20 01:28:14

consumption improves fat-free mass, plasma HDL-cholesterol and insulin sensitivity in healthy men with normal BMI compared to peanut oil. In: Clinical Nutrition...

Click to read more »
Still Alice – Mein Leben ohne Gestern
Jumat, 2026-05-15 23:35:34

is a heartfelt drama that honors its delicate themes with bravery and sensitivity.) Bei Metacritic erhält der Film eine Bewertung von 72/100, basierend...

Click to read more »
Kohlenstoffdioxid in der Erdatmosphäre
Rabu, 2026-07-08 06:47:14

1073/pnas.0812721106 (englisch).  Richard E. Zeebe: Time-dependent climate sensitivity and the legacy of anthropogenic greenhouse gas emissions. In: pnas. 110...

Click to read more »
Wissen
Minggu, 2026-08-02 20:32:45

Interest. Oxford University Press 2005. John MacFarlane: The Assessment Sensitivity of Knowledge Attributions. Oxford Studies in Epistemology 1 (2005), S...

Click to read more »
Speisesalz
Kamis, 2026-06-25 16:27:41

(wiley.com [abgerufen am 18. Mai 2025]).  V. Franco, S. Oparil: Salt sensitivity, a determinant of blood pressure, cardiovascular disease and survival...

Click to read more »
Myalgische Enzephalomyelitis/Chronisches Fatigue-Syndrom
Senin, 2026-08-10 04:14:10

Nelson, Jonathan D. Buckley, Rebecca L. Thomson et al.: Diagnostic sensitivity of 2-day cardiopulmonary exercise testing in Myalgic Encephalomyelitis/Chronic...

Click to read more »
Pentosanpolysulfat-Natrium
Kamis, 2026-04-23 13:58:40

Albrecht: Effect of pentosan polysulfate therapy on intravesical potassium sensitivity. In: Urology. 59. Jahrgang, Nr. 3, 2002, S. 329–333, doi:10.1016/s0090-4295(01)01586-2...

Click to read more »
Meares Irlen Syndrom
Minggu, 2026-05-17 21:37:34

Meares-Irlen-Syndrom, auch Irlen-Syndrom, Visual Stress oder Scotopic Sensitivity Syndrome (skotopisches Sensitivitätssyndrom), werden visuelle Missempfindungen...

Click to read more »
Flughafen
Minggu, 2026-03-01 01:41:58

unterschiedlich bewertet wird. Das Umweltbundesamt definiert einen Noise Sensitivity Depreciation Index (NSDI) mit 0,87 % je dB(A) als Ergebnis einer Auswertung...

Click to read more »
Liste der Abkürzungen zur globalen Erwärmung
Kamis, 2026-07-02 02:44:47

ECS Equilibrium Climate Sensitivity Gleichgewichtsklimasensitivität EHS Emissionshandelssystem EITE emisson-intensive und trade exposed emissionsintensive...

Click to read more »
Jordan Peterson
Sabtu, 2026-06-27 17:34:35

(researchgate.net).  Stewart S. H., Peterson J. B., Pihl R. O.: Anxiety sensitivity and self-reported alcohol consumption rates in university women. In:...

Click to read more »
Nilflughund
Sabtu, 2026-07-04 02:01:11

Abgerufen am 9. Januar 2018.  D. R. Griffin, A. Novick, M. Kornfield: The sensitivity of echolocation in the fruit bat, rousettus. In: The Biological Bulletin...

Click to read more »
Herpes-simplex-Enzephalitis
Sabtu, 2025-11-29 17:41:54

(2001) 248(6), S. 469–477. (Review) PMID 11499636 F. Focher u. a.: Sensitivity of monkey B virus (Cercopithecine herpesvirus 1) to antiviral drugs:...

Click to read more »
Polychlorierte Dibenzodioxine und Dibenzofurane
Selasa, 2026-05-12 03:13:12

D. Jones, Y. Wan, B. Collins, J. L. Newsted, D. Kay, S. J. Bursian: Sensitivity of Japanese quail (Coturnix japonica), Common pheasant (Phasianus colchicus)...

Click to read more »
Cuticula (Pflanzen)
Jumat, 2026-05-08 03:27:55

E. Kolattukudy: Biosynthetic pathways of cutin and waxes, and their sensitivity to environmental stresses. In: G. Kerstiens (Hrsg.): Plant Cuticles....

Click to read more »
Nährmedium
Selasa, 2026-06-02 03:59:33

Ralf Reski (1995) Gelrite and agar differently influence cytokinin-sensitivity of a moss. Journal of Plant Physiology 146, 369–371. Eckhard Bast: Mikrobiologische...

Click to read more »
Numerische Wettervorhersage
Jumat, 2026-06-19 21:43:03

und COSMO-ART, auf dwd.de Modeling of gas and aerosol with WRF/Chem over Europe: Evaluation and sensitivity study, auf agupubs.onlinelibrary.wiley.com...

Click to read more »
Opioide
Rabu, 2026-04-22 01:28:23

ISBN 3-13-140543-0. Martin S. Angst, Nicholas G. Phillips et al.: Pain sensitivity and opioid analgesia: a pharmacogenomic twin study. In: Pain. 2012. doi:10...

Click to read more »
Rückwärtige Belichtung
Jumat, 2026-04-17 19:17:08

back-illuminated CMOS image sensor, realizing high picture quality, nearly twofold sensitivity(*1) and low noise. In: sony.com. 11. Juni 2008, abgerufen am 19. Februar...

Click to read more »
Michael Hantel
Rabu, 2026-08-05 19:17:42

Band 67, 1998, S. 135–152. mit M. Ehrendorfer, A. Haslinger: Climate Sensitivity of Snow Cover Duration in Austria, International Journal of Climatology...

Click to read more »
Marcus Conrad
Minggu, 2026-06-28 05:14:24

José Pedro Friedmann Angeli, Marcus Conrad: ACSL4 dictates ferroptosis sensitivity by shaping cellular lipid composition. In: Nature Chemical Biology. Band 13...

Click to read more »
Emma Kirkby
Kamis, 2026-08-06 00:03:23

with minimal vibrato, her natural declamation, agile coloratura and her sensitivity to words have been widely admired by interpreters of early, Renaissance...

Click to read more »
A-nicht-B-Suchfehler
Minggu, 2025-01-12 19:05:17

Topal, G. Gergely, A. Erdohegyi, G. Csibra, A. Miklosi: Differential Sensitivity to Human Communication in Dogs, Wolves, and Human Infants. In: Science...

Click to read more »
Konjugierte Linolsäuren
Selasa, 2026-01-06 07:46:51

3165), increase in lean body mass (ID 498, 731), increase in insulin sensitivity (ID 1517), protection of DNA, proteins and lipids from oxidative damage...

Click to read more »
Elektrosmog
Jumat, 2026-06-26 21:44:35

Phone Base Station Signals Increase Symptoms in Individuals Who Report Sensitivity to Electromagnetic Fields? A Double-Blind Randomized Provocation Study...

Click to read more »
Kernspinresonanzspektroskopie
Kamis, 2026-03-26 19:10:37

abundance double quantum transfer spectroscopy) 13C-ADEQUAT (adequate sensitivity double quantum transfer spectroscopy) 1D/2D-DOSY (diffusion ordered spectroscopy)...

Click to read more »
Neurodiversität
Selasa, 2026-06-30 21:36:54

Abgerufen am 22. Januar 2025 (englisch).  Belek: Articulating Sensory Sensitivity: From Bodies with Autism to Autistic Bodies. In: Medical Anthropology...

Click to read more »
Glomeruläre Filtrationsrate
Jumat, 2026-06-05 21:50:53

G. Filler, F. Priem, I. Vollmer, J. Gellermann, K. Jung: Diagnostic sensitivity of serum cystatin for impaired glomerular filtration rate. In: Pediatric...

Click to read more »
Oligozän
Sabtu, 2026-06-27 20:57:36

  James Hansen, Makiko Sato, Gary Russell, Pushker Kharecha: Climate sensitivity, sea level and atmospheric carbon dioxide. In: Philosophical Transactions...

Click to read more »
Chloroquin
Kamis, 2026-06-18 13:41:34

Markus Winterberg, Nicholas PJ Day, Joel Tarning, Daniel Blessborn: High sensitivity methods to quantify chloroquine and its metabolite in human blood samples...

Click to read more »
Low-Carb
Selasa, 2026-04-14 16:55:29

abgerufen am 4. März 2011]).  Mark E Daly: Acute effects on insulin sensitivity and diurnal metabolic profiles of a high-sucrose compared with a high...

Click to read more »
Lukas Klaschinski
Jumat, 2026-02-27 14:09:11

Schröder-Abé: Benefits of power posing: effects on dominance and social sensitivity. In: Comprehensive Results in Social Psychology. Band 2, Nr. 1, 2. Januar...

Click to read more »
PICO
Kamis, 2026-05-07 14:30:49

Outcome = Lebensqualität McMaster University (PICO) Agoritsas T et al.: Sensitivity and predictive value of 15 PubMed search strategies to answer clinical...

Click to read more »
Stickstoffhypoxie
Minggu, 2026-04-26 02:21:56

NOX4-dependent neuronal autotoxicity and BBB breakdown explain the superior sensitivity of the brain to ischemic damage. In: Proceedings of the National Academy...

Click to read more »
Galactose-α-1,3-galactose
Minggu, 2026-01-25 08:49:41

Correlation between clinical findings and laboratory tests for alpha gal sensitivity. In: Annals of Allergy, Asthma & Immunology. Band 119, Nr. 5, November...

Click to read more »
Methan
Senin, 2026-08-10 00:24:40

Bruce Buffett, David Archer: Global inventory of methane clathrate: sensitivity to changes in the deep ocean. In: Earth and Planetary Science Letters...

Click to read more »
Digitalkamera
Rabu, 2026-05-27 15:39:45

Kontrastempfindungsfunktion (Contrast Sensitivity Function, CSF) über der Ortsfrequenz in Linienpaaren pro Bildhöhe...

Click to read more »
Beurteilung eines binären Klassifikators
Sabtu, 2025-11-22 02:09:25

(auch Richtig-positiv-Rate, Empfindlichkeit oder Trefferquote; englisch sensitivity, true positive rate, recall oder hit rate) gibt die Wahrscheinlichkeit...

Click to read more »
Tetrahydrocannabivarin
Minggu, 2026-01-25 00:13:37

The cannabinoid Δ(9)-tetrahydrocannabivarin (THCV) ameliorates insulin sensitivity in two mouse models of obesity. In: Nutrition & diabetes. Band 3, 2013...

Click to read more »
Stillen
Selasa, 2026-08-04 23:17:31

John R. Britton, Helen L. Britton, Virginia Gronwaldt: Breastfeeding, Sensitivity, and Attachment. Pediatrics, Band 118, Heft 5, November 2006 (Abstract)...

Click to read more »
Mentalisierung
Sabtu, 2026-08-08 01:22:37

E. Mains, C. Fernyhough, E. Fradley, M. Tuckey: Rethinking maternal sensitivity: Mothers’ comments on infants mental processes predict security of attachment...

Click to read more »
COVID-19-Pandemie
Rabu, 2026-08-12 09:25:17

Imperial College London, Report 4. Neil M. Ferguson et al.: Relative sensitivity of international surveillance (PDF) (Memento vom 5. März 2020 im Internet...

Click to read more »
Gamersprache
Rabu, 2026-07-22 22:20:30

Highsenser stellen die Geschwindigkeit bzw. die Genauigkeit (von engl. sensitivity) der Maus hoch ein und können daher in Ego-Shootern sehr schnell reagieren...

Click to read more »
Backpropagation
Kamis, 2026-03-12 02:07:49

University 1974. Paul Werbos: Applications of advances in nonlinear sensitivity analysis. In: System modeling and optimization. Springer, Berlin/Heidelberg...

Click to read more »
Morbus Behçet
Selasa, 2026-06-02 17:01:49

Behçet’s Disease (ICBD): a collaborative study of 27 countries on the sensitivity and specificity of the new criteria. In: Journal of the European Academy...

Click to read more »
Thomas M. Klapötke
Kamis, 2025-12-25 19:58:07

Keshavarz, Thomas M. Klapötke, The Properties of Energetic Materials - Sensitivity, Physical and Thermodynamic Properties, 2. Auflage, de Gruyter, Berlin...

Click to read more »
Globale Erwärmung
Senin, 2026-08-10 00:16:39

Jonathan LaRiviere, Ana Christina Ravelo: High Earth-system climate sensitivity determined from Pliocene carbon dioxide concentrations. In: Nature Geoscience...

Click to read more »
Höchstspannungsleitung
Jumat, 2026-05-08 07:32:25

Jeffery: The spectral transmission of ocular media suggests ultraviolet sensitivity is widespread among mammals. In: Proc. R. Soc. B., 2014, S. 281(1780);...

Click to read more »
Niederschlagsradar
Sabtu, 2026-06-06 01:40:54

Zeit nach dem Impuls. Diese zeitabhängige Verstärkungsregelung wird sensitivity time control genannt. Stärke des Echosignals: Diese hängt sowohl von...

Click to read more »
Permafrost
Rabu, 2026-06-10 10:54:23

Frederick, Jorien E Vonk: Subsea permafrost carbon stocks and climate change sensitivity estimated by expert assessment. In: Environmental Research Letters. Band 15...

Click to read more »
Kohlenstoffkreislauf
Kamis, 2026-07-16 21:30:46

Eleanor J. Burke, Charles D. Koven: A spatial emergent constraint on the sensitivity of soil carbon turnover to global warming. In: Nature Communications...

Click to read more »
Hebephilie
Rabu, 2026-04-08 21:42:12

Hebephilie in das DSM-5 von Karen Franklin James M. Cantor, Ian V. McPhail: Sensitivity and Specificity of the Phallometric Test for Hebephilia. In: The Journal...

Click to read more »
Encounter (Psychologie)
Senin, 2026-05-04 05:45:19

den wichtigsten Therapieformen zählen Basic Encounter von Carl Rogers, Sensitivity Training in der Gruppendynamik, Open Encounter von Will Schutz, Casriel-Therapie...

Click to read more »
Eva Luna (Roman)
Minggu, 2026-07-12 16:27:37

recruits“ – Cox, Eva Luna, S. 78. „macho code“ – Cox, Eva Luna, S. 84. „sensitivity despite his hard exterior“ – Cox, Eva Luna, S. 86. „sexist guerrilla“...

Click to read more »
Hintertuxer Gletscher
Kamis, 2026-07-23 20:23:06

Olivier Gagliardini, Delphine Six, Guillaume Gastineau, Christian Vincent: Sensitivity of Glaciers in the European Alps to Anthropogenic Atmospheric Forcings:...

Click to read more »
Piperin
Selasa, 2026-03-03 19:17:45

the Derivatives in Long Pepper Extract by HPLC Using Relative Molar Sensitivity. In: Food Hygiene and Safety Science (Shokuhin Eiseigaku Zasshi). Band 60...

Click to read more »
PSL
Jumat, 2026-06-05 15:10:47

Soccer League, höchste Spielklasse im südafrikanischen Fußball Process Sensitivity Level, Maß der Elektronik zur Empfindlichkeit eines Bauteils Process...

Click to read more »
Creatin-Kinase
Minggu, 2026-03-01 22:22:16

Phosphocreatine Circuit: Molecular and Cellular Physiology of Creatine Kinases, Sensitivity to Free Radicals, and Enhancement by Creatine Supplementation. In: Valdur...

Click to read more »
Galoppierender Treibhauseffekt
Senin, 2026-05-11 02:25:31

1810141115 James Hansen, Makiko Sato, Gary Russell, Pushker Kharecha: Climate sensitivity, sea level and atmospheric carbon dioxide. In: Philosophical Transansactions...

Click to read more »
Geographie Australiens
Rabu, 2025-03-19 20:26:33

höchster Punkt: Big Ben, Heard-Insel: 2745 m Miller, Gifford et al. Sensitivity of the Australian Monsoon to insolation and vegetation: Implications...

Click to read more »
Biodiesel
Kamis, 2026-08-06 07:16:00

Michael R. Olson, Tomoaki Okuda, Kenneth A. Walz, James J. Schauer: Sensitivity of hazardous air pollutant emissions to the combustion of blends of petroleum...

Click to read more »
Emetophobie
Sabtu, 2026-01-31 19:38:47

K. Bouman: An internet-based study on the relation between disgust sensitivity and emetophobia. In: Journal of Anxiety Disorders. 2008, 22(3), S. 524–531...

Click to read more »
Fettsäure-Elongasen
Jumat, 2026-03-06 21:11:07

Shimano H: Elovl6: a new player in fatty acid metabolism and insulin sensitivity. In: J Mol Med. 87. Jahrgang, Nr. 4, April 2009, S. 379–84, doi:10...

Click to read more »
ATP-Synthase
Rabu, 2026-08-12 19:31:24

ATP5E F1ε 51 606153 20q13.3 ATP5O F1O 213 600828 21q22.1-22.2 Oligomycin sensitivity conferral protein ATP5F1 Fob 256 603270 1p13.2 ATP5G1 Foc Isoform 1 136...

Click to read more »
Epworth Sleepiness Scale
Senin, 2024-04-15 20:59:55

(Offizielle Website), abgerufen am 21. Januar 2013. Murray W. Johns: Sensitivity and specificity of the multiple sleep latency test (MSLT), the maintenance...

Click to read more »
Forschungsgeschichte des Klimawandels
Minggu, 2026-06-14 17:45:30

Climate Model with Seasonal Variation for Future Studies of Climate Sensitivity. In: Dynamics of Atmospheres and Oceans 3, 1979, S. 393–426 J. D. Hays...

Click to read more »
Lärm
Selasa, 2026-05-19 07:46:36

J Hautus, Kauko Heikkilä: Elucidating the relationship between noise sensitivity and personality. In: Noise & Health. Band 17, Nr. 76, 2015, S. 165–171...

Click to read more »
Wirkungsgrad
Senin, 2026-06-08 17:25:08

Audiodateien Kennschalldruckpegel und Wirkungsgrad bei passiven Lautsprechern (sensitivity) Wirkungsgrad von Bühnenscheinwerfern Energetischer Wirkungsgrad – Erklärung...

Click to read more »
Psychologische Unterschiede zwischen Männern und Frauen
Sabtu, 2026-07-25 19:41:50

researchgate.net).  Di You, Yukiko Maeda: Gender Differences in Moral Sensitivity: A Meta-Analysis. In: Ethics & Behavior. 21. Jahrgang, Nr. 4, 2011, S...

Click to read more »
Kleinschreibung
Rabu, 2026-05-13 03:16:55

Staaten von Amerika“ und Svenska kyrkan „die schwedische Kirche“. Case sensitivity Binnenmajuskel Wiktionary: Kleinschreibung – Bedeutungserklärungen, Wortherkunft...

Click to read more »
Klimageschichte
Rabu, 2026-03-18 15:21:58

1073/pnas.0812721106 (englisch).  Richard E. Zeebe: Time-dependent climate sensitivity and the legacy of anthropogenic greenhouse gas emissions. In: PNAS. Band 110...

Click to read more »
Palmitoleinsäure
Rabu, 2026-07-01 13:08:53

Luis Martinez: Purified palmitoleic acid for the reduction of high-sensitivity C-reactive protein and serum lipids: A double-blinded, randomized, placebo...

Click to read more »
Diedrich Diederichsen (Kulturwissenschaftler)
Selasa, 2026-07-07 18:42:08

978-3-943365-76-4 (deutsch) Love and Ethnology. The Colonial Dialectic of Sensitivity (after Hubert Fichte) / Liebe und Ethnologie. Die koloniale Dialektik...

Click to read more »
Bernd Lößner
Sabtu, 2026-03-21 22:59:36

(AgRuD)-Patientenberatungsstelle der Deutschen Gesellschaft Multiple-Chemical-Sensitivity (DGMCS) e.V. tätig. Bernd Lößner verstarb am 6. Februar 2014 im Alter...

Click to read more »
Parkinson Neuropsychometric Dementia Assessment
Sabtu, 2026-07-11 19:50:42

Tools with Age Correction and Weighting of Subtests According to Their Sensitivity and Specificity. In: Journal of Alzheimer’s Disease. 34, 2013, S. 813–834...

Click to read more »
Kernphotoeffekt
Selasa, 2025-11-25 06:00:04

3834818151 W. Rapp, J. Görres, M. Wiescher, H. Schatz, F. Käppeler: Sensitivity of p-Process Nucleosynthesis to Nuclear Reaction Rates in a 25 M☉ Supernova...

Click to read more »
Mikrobarome
Kamis, 2024-08-22 21:01:33

Oktober 2023, abgerufen am 10. Oktober 2023. Albatross movement suggests sensitivity to infrasound cues at sea pnas.org, 9. Oktober 2023, abgerufen am 10...

Click to read more »
Politische Korrektheit
Jumat, 2026-07-31 18:43:20

the homosexuality of a famous athlete, he was required to attend gay-sensitivity sessions and publish a piece of self-criticism in the student newspaper...

Click to read more »
Feldhamster
Jumat, 2026-07-17 20:09:51

Wollnik: Seasonal variations in circadian rhythms coincide with a phase of sensitivity to short photoperiods in the European hamster. In: Journal of Comparative...

Click to read more »
Oraler Glukosetoleranztest
Rabu, 2026-04-22 00:53:53

abgerufen am 20. Februar 2011 (englisch).  M Matsuda, RA DeFronzo: Insulin sensitivity indices obtained from oral glucose tolerance testing: comparison with...

Click to read more »
Braunes Fettgewebe
Sabtu, 2026-06-06 15:38:51

mirabegron treatment increases human brown fat, HDL cholesterol, and insulin sensitivity. In: Journal of Clinical Investigation. Band 130, Nr. 5, 23. März 2020...

Click to read more »
Goldmulle
Sabtu, 2025-12-13 07:21:17

276, 2015, S. 900–914 Matthew J. Mason und Peter M. Narins: Seismic sensitivity in the Desert golden mole (Eremitalpa granti): A review. Journal of Comparative...

Click to read more »
Großschreibung
Jumat, 2026-04-03 14:41:37

bestimmte) Kirche gelten keine einheitlichen Regeln. Binnenmajuskel Case sensitivity Brigitte Labs-Ehlert: Versalschreibung in althochdeutschen Sprachdenkmälern...

Click to read more »
Phagentherapie
Selasa, 2026-08-11 15:51:15

Kaitlyn E. Kortright, Deepak Narayan: Phage selection restores antibiotic sensitivity in MDR Pseudomonas aeruginosa. In: Scientific Reports. Band 6, 26. Mai...

Click to read more »
Jeffrey Alan Gray
Sabtu, 2024-06-08 14:28:47

Modifikation des Temperamentsmodells von Eysenck bekannt (Reinforcement Sensitivity Theorie). In diesem Zusammenhang arbeitete er an dem Verhaltensaktivierungssystem...

Click to read more »
Meeresspiegelanstieg seit 1850
Jumat, 2026-06-19 16:17:29

Gregory J. Hakim, Christopher J. Poulsen: Glacial cooling and climate sensitivity revisited. In: Nature. 584. Jahrgang, Nr. 7822, August 2020, S. 569–573...

Click to read more »
Geschmacksstörung
Sabtu, 2026-02-07 04:13:26

PMID 18628146. R. Matsuo: Role of saliva in the maintenance of taste sensitivity. In: Critical Reviews in Oral Biology and Medicine. Band 11, Nummer 2...

Click to read more »
Slump-Test (Neurologie)
Rabu, 2026-03-18 14:19:46

September 2014, C. Lange J. Majlesi, H. Togay, H. Unalan, S. Toprak: The sensitivity and specificity of the Slump and the Straight Leg Raising tests in patients...

Click to read more »
Digital Polymerase Chain Reaction
Senin, 2018-11-12 03:16:36

Grant, E. Nastouli, C. A. Foy, J. F. Huggett: Comparative study of sensitivity, linearity, and resistance to inhibition of digital and nondigital polymerase...

Click to read more »
Attachment Parenting
Jumat, 2026-07-17 18:06:19

haben sie dafür den Begriff der mütterlichen Feinfühligkeit (maternal sensitivity) übernommen: Die Frau richtet ihre Aufmerksamkeit ganz aufs Kind („Babyreading“)...

Click to read more »
Ligyrophobie
Selasa, 2026-06-02 18:17:54

Goodworth: Sound Tolerance Conditions (Hyperacusis, Misophonia, Noise Sensitivity, and Phonophobia): Definitions and Clinical Management. In: American...

Click to read more »
Verhalten (Biologie)
Selasa, 2025-06-24 15:48:53

Efrat Dener, Alex Kacelnik und Hagai Shemesh: Pea Plants Show Risk Sensitivity. In: Current Biology. Band 26, Nr. 13, 2016, S. 1763–1767, doi:10.1016/j...

Click to read more »
Friedrich Luft (Mediziner)
Jumat, 2025-08-01 03:41:27

E. Grim, N. S. Fineberg: Definitions and characteristics of sodium sensitivity and blood pressure resistance. In: Hypertension, Band 8, Supl. II, 1986...

Click to read more »
Gödel-Preis
Jumat, 2026-06-05 22:26:19

Nissim und Adam Davison Smith für ihren Aufsatz Calibrating Noise to Sensitivity in Private Data Analysis zu Differential Privacy 2018 Oded Regev für...

Click to read more »
Reaktorsicherheit
Senin, 2026-07-06 02:17:38

Anne-Sophie Hacquin, Sacha Altay, Lene Aarøe, Hugo Mercier: Disgust sensitivity and public opinion on nuclear energy. In: Journal of Environmental Psychology...

Click to read more »
Fusarium
Kamis, 2026-08-06 19:08:02

new meat substitute, UPI, April 7, 2020 S. J. Katona, E. R. Kaminski: Sensitivity to Quorn mycoprotein (Fusarium venenatum) in a mould allergic patient...

Click to read more »
Jan-Heiner Tück
Jumat, 2026-07-17 01:57:50

theology, philosophy, and literature, and with a commendable ecumenical sensitivity, Tück achieves in this insightful work a remarkable fusion of theology...

Click to read more »
Solarisation (Fotografie)
Selasa, 2026-07-28 23:16:15

Fotokinoverlag, Leipzig 1974, S. 74–75.  Tadaaki Tani: Photographic Sensitivity: Theory and Mechanisms. Oxford University Press, New York 1995, ISBN...

Click to read more »
Orthokeratologie
Jumat, 2025-08-08 19:14:26

on visual acuity, refractive error, corneal topography and contrast sensitivity. In: Eye & contact lens. 34, 4, 2008, S. 224–248. Kojima, Hasegawa, Hara...

Click to read more »
Ammoniumheptamolybdat
Sabtu, 2026-01-24 15:23:52

J. Borge, J. Dubochet: Cryo-negative staining reduces electron-beam sensitivity of vitrified biological particles, in: Journal of Structural Biology...

Click to read more »
Shure SM57
Minggu, 2025-07-27 04:54:34

Tonaderspeisung. Die Anschlussimpedanz beträgt etwa 310 Ohm. Die Empfindlichkeit (Sensitivity) liegt bei 1 kHz bei −56,0 dBV/Pa (1,60 mV/Pa); der zulässige maximale...

Click to read more »
Magnetsinn
Rabu, 2026-07-22 16:44:28

orientation and navigation of juvenile alligators: evidence of magnetic sensitivity. In: Journal of Comparative Physiology A. Band 154, Nr. 5, 1984, S. 649–658...

Click to read more »
Ekel
Jumat, 2026-07-24 15:40:32

Crowell, David Tang, Eddie Harmon-Jones, Brandon J. Schmeichel: Disgust sensitivity predicts defensive responding to mortality salience. In: Emotion. Band 15...

Click to read more »
Rating of perceived exertion
Rabu, 2024-12-11 21:12:24

J. McMurray, H. Dargie: A Comparison of the Reproducibility and the Sensitivity to Change of Visual Analogue Scales, Borg Scales, and Likert Scales in...

Click to read more »
Gertrude Rand
Jumat, 2025-08-08 19:44:28

promovierte. Ihre Dissertation trug den Titel: The factors that influence the sensitivity of the retina to color: A quantitative study and methods of standardizing...

Click to read more »
Befindlichkeitsstörung
Sabtu, 2025-06-14 18:11:34

Epidemische Neuromyasthenie, Fibromyalgie (Fibrositis), Multiple Chemical Sensitivity, Chronisches Fatigue-Syndrom. Die Einordnung des Chronischen Fatigue-Syndroms...

Click to read more »
Verhaltenshemmung
Sabtu, 2018-09-29 00:08:17

Jeffrey Alan Gray (1982, 1987, 1990) unterscheidet nach der Reinforcement Sensitivity Theorie drei biologische Systeme, die das Verhalten steuern sollen: das...

Click to read more »
Wolfgang Schamel
Selasa, 2025-11-25 21:31:32

P. Dopfer, D. L. Wiest, L. A. Turka, W. W. Schamel, E. Palmer: High-sensitivity detection and quantitative analysis of native protein-protein interactions...

Click to read more »
Laser Interferometer Space Antenna
Jumat, 2026-07-03 15:09:31

Yamamoto, C. C. Yancey, H. Yu, L. Zhang, M. E. Zucker, J. Zweizig: Sensitivity of the Advanced LIGO detectors at the beginning of gravitational wave...

Click to read more »
EQ. Emotionale Intelligenz
Selasa, 2026-01-20 12:27:18

104 Emotional Intelligence (1995), S. 104; Robert Rosenthal et al.: Sensitivity to Nonverbal Communication: The PONS Test, The Johns Hopkins University...

Click to read more »
Ortsfrequenz
Sabtu, 2025-12-27 17:31:40

Objekts wird als Kontrastempfindlichkeitsfunktion (englisch Contrast Sensitivity Function (CSF)) angegeben. Sie ist das Produkt aus der rein optischen...

Click to read more »
SISI-Test
Senin, 2018-11-05 13:25:39

Der SISI-Test (Short Increment Sensitivity Index) ist eine audiometrische Methode der Hals-Nasen-Ohrenheilkunde, mit der die Erkennbarkeit kleiner...

Click to read more »
Lutz Eckstein
Selasa, 2026-04-21 15:09:53

Transportmittel 2012. Braunschweig 2012. mit M. Wimmershof, C. Klas, A. Zlocki: Sensitivity analysis for model based fusion of camera systems with navigation data...

Click to read more »
Grüner Blattwurm
Kamis, 2020-05-14 16:06:11

Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...

Click to read more »
Solar-C
Selasa, 2026-06-16 06:45:20

Der High-sensitivity Solar Ultraviolet Spectroscopic Satellite, kurz Solar-C, ist ein geplantes Weltraumteleskop zur Sonnenbeobachtung, das von der japanischen...

Click to read more »
Transparency International
Kamis, 2026-05-14 23:10:58

Fehleinschätzung (political bias) und die Fehleinschätzung durch Sensitivität (sensitivity bias) bzw. die soziale Erwünschtheit als Hauptursachen fehlerhafter Ergebnisse...

Click to read more »
Bunter Kalkröhrenwurm
Kamis, 2024-03-21 23:28:51

Hawkins, R. Seed: Biogenic Reefs (volume IX). An overview of dynamic and sensitivity characteristics for conservation management of marine SACs. Scottish...

Click to read more »
Abkürzungen/Luftfahrt/S–Z
Selasa, 2026-03-10 15:33:13

Straight-in Direktanflug (zur Landung) S Standby Reserve, Bereitschaft S Sensitivity Level   (S) Summer Time Sommerzeit SA Selective Availability künstlich...

Click to read more »
Altern
Sabtu, 2026-08-08 00:20:48

Patterson: Dietary Fat and Carbohydrates Differentially Alter Insulin Sensitivity During Caloric Restriction. In: Gastroenterology. Band 136, Nr. 5, 1...

Click to read more »
Liste von Psychotherapie- und Selbsterfahrungsmethoden
Minggu, 2026-02-15 19:15:00

oder Organisationslaboratorium Selbsterfahrungsgruppe Encounter-Gruppe Sensitivity-Gruppe TZI-Gruppe Therapeutische Gemeinschaft nach S. H. Foulkes, Wilfred...

Click to read more »
Schwingquarz
Jumat, 2026-04-17 20:24:48

US4419600: Stress-compensated quartz resonators.‌ Patent US5686779: High sensitivity temperature sensor and sensor array.‌ Y Cut Crystal (Memento vom 30....

Click to read more »
Bioassay
Selasa, 2025-10-14 09:11:53

wissenschaft-online.de/abo/lexikon/biok/1508. K.M. Dorries et al. (1997). Sensitivity and behavioral responses to the pheromone androstenone are not mediated...

Click to read more »
Pyrolant
Senin, 2024-03-04 22:26:29

Seminar. 1992, S. 539. T. Kuwahara, T. Kohno, C. H. Wang: Static Electric Sensitivity Characteristics of Zr/BaCrO4, Pyrolants. In: Prop., Explos., Pyrotech...

Click to read more »
KATRIN
Senin, 2026-05-04 19:29:37

pdf, 10,9 MB Direct neutrino-mass measurement with sub-electronvolt sensitivity, Nature, 14. Februar 2022 [1] First constraints on general neutrino interactions...

Click to read more »
Kompaktleuchtstofflampe
Jumat, 2026-04-17 14:52:03

Environmental impacts of lighting technologies — Life cycle assessment and sensitivity analysis. In: Environmental Impact Assessment Review. Band 31, 2011,...

Click to read more »
Große Wachsmotte
Senin, 2026-04-27 12:33:48

Landwirtschaftsverlag 1984 Hannah M. Moir et al.: Extremely high frequency sensitivity in a ‘simple’ ear. In: Biology Letters. Band 9, Nr. 4, 2013, doi:10.1098/rsbl...

Click to read more »
Folgen der globalen Erwärmung
Kamis, 2026-07-30 02:47:09

B. Buffet, D. Archer (2004): Global inventory of methane clathrate: sensitivity to changes in the deep ocean, in: Earth and Planetary Science Letters...

Click to read more »
Strahlungshärten
Selasa, 2026-06-09 17:59:16

verstärkten Effekten mit niedriger Dosisleistung (engl. enhanced low dose rate sensitivity, ELDRS), Neutronen- und Protonenverschiebungsschäden und Einzelereigniseffekten...

Click to read more »
Robert Hummel
Rabu, 2025-11-26 09:08:37

Hummel zu Gegen die Angst Podcast Stichwort Drehbuch mit Robert Hummel zu Sensitivity-Beratung https://www.filmstoffentwicklung.de/2016/gaeste/robert-hummel/...

Click to read more »
Berthelot-Reaktion
Jumat, 2025-01-31 16:13:41

2023.  (PDF; 8 kB). Tsuboi, T.; Hirano, Y.; Shibata, Y.; Motomizu, S.: Sensitivity Improvement of Ammonia Determination Based on Flow-Injection Indophenol...

Click to read more »
Sebsi
Senin, 2021-02-08 05:47:14

Improves Night Vision: A Case Study of Dark Adaptometry and Scotopic Sensitivity in Kif Smokers of the Rifmountains of Northern Morocco. In: Journal of...

Click to read more »
Rana Adhikari
Selasa, 2025-06-03 02:39:06

promoviert wurde mit einer Arbeit über Gravitationswellendetektoren (Sensitivity and noise analysis of 4 km laser interferometric gravitational wave antennae)...

Click to read more »
Blutzuckerregulation
Kamis, 2026-06-11 19:46:23

simple mathematical model supporting fast in-vivo estimation of insulin sensitivity and beta cell function. In: Scientific Reports. Band 12, Nr. 1, 21. Oktober...

Click to read more »
G*Power
Senin, 2025-04-14 20:33:03

erreichte Power, wenn α, Stichprobengröße und Effektgröße vorgegeben sind, "Sensitivity": Berechnet die Effektgröße, wenn α, Power und Stichprobengröße vorgegeben...

Click to read more »
Macula densa
Jumat, 2024-12-13 15:36:04

angiotensin II and nitric oxide on the afferent arteriole influence sensitivity of the tubuloglomerular feedback. In: Frontiers in Physiology. Band 4...

Click to read more »
Rawson Marshall Thurber
Kamis, 2021-11-04 20:37:06

Produzent (Executive Producer) 2004: Terry Tate, Office Linebacker: Sensitivity Training 2021: Red Notice Rawson Marshall Thurber bei IMDb Interview...

Click to read more »
Feindesliebe
Rabu, 2026-01-14 17:56:11

Jüdischer Verlag, 1982, ISBN 3-7610-0370-6, S. 614f. David Flusser: A new Sensitivity in Judaism and the Christian Message. Harvard Theological Review 61/1968...

Click to read more »
Modulationsübertragungsfunktion
Minggu, 2025-12-21 23:17:35

durch die Kontrastempfindlichkeitsfunktion beschrieben (CSF = Contrast Sensitivity Function). Das menschliche Auge ist bei rund 200 Linienpaare pro Bildbreite...

Click to read more »
Hans Oberleithner
Rabu, 2025-03-19 12:17:13

Kusche-Vihrog, Hans Oberleithner: An emerging concept of vascular salt sensitivity. In: F1000 Biology Reports. Band 4, 2. Oktober 2012, doi:10.3410/B4-20...

Click to read more »
Freelite
Rabu, 2026-05-20 15:17:21

for free kappa and free lambda immunoglobulin light chains: relative sensitivity for detection of monoclonal light chains. In: Clinical Chemistry. 48...

Click to read more »
Chemical Injury Information Network
Sabtu, 2025-06-28 03:41:53

von Cynthia Wilson. Robert S. Mayer: Strategies for Surviving Chemical Sensitivity. 2010, ISBN 978-0-578-05548-0 (englisch).  Offizielle Website von Chemical...

Click to read more »
Reto Knutti
Sabtu, 2025-12-27 20:33:18

et al.: Global warming under old and new scenarios using IPCC climate sensitivity range estimates. In: Nature Climate Change. Band 2, 2012, S. 248–253...

Click to read more »
Känozoisches Eiszeitalter
Sabtu, 2026-06-27 01:36:02

Gregory J. Hakim, Christopher J. Poulsen: Glacial cooling and climate sensitivity revisited. In: Nature. Band 584, Nr. 7822, August 2020, S. 569–573, doi:10...

Click to read more »
Lisa Barsotti
Jumat, 2026-01-23 23:57:21

(Laudatio). The LIGO Scientific Collaboration: Exploring the sensitivity of next generation gravitational wave detectors, Classical and Quantum...

Click to read more »
Rainer Schandry
Kamis, 2026-01-15 00:10:05

Schandry, C. Leopold, W. P. Oettinger, H. Berg, R. Kulzer, J. Tritschler: Sensitivity of humans to low-frequency magnetic fields. In: Proc. EMC '96. 1996....

Click to read more »
Moran Magal
Sabtu, 2026-06-06 06:28:10

Bacharach in Israel teil. 2013 veröffentlichte sie ihr zweites Album Over Sensitivity. Dieses Album enthält ausschließlich Lieder auf Hebräisch. Im selben...

Click to read more »
Freie Leichtketten
Kamis, 2026-03-05 14:14:29

for free kappa and free lambda immunoglobulin light chains: relative sensitivity for detection of monoclonal light chains. In: Clinical Chemistry. 48...

Click to read more »
FosB
Selasa, 2026-07-07 13:13:55

Nestler: Expression of the transcription factor ΔFosB in the brain controls sensitivity to cocaine. In: Nature. Band 401, Nr. 6750, 1999, S. 272–276, doi:10...

Click to read more »
Hangenberg-Ereignis
Sabtu, 2024-12-21 07:15:23

Julia Brugger, Matthias Hofmann, Stefan Petri, Georg Feulner: On the Sensitivity of the Devonian Climate to Continental Configuration, Vegetation Cover...

Click to read more »
Ralph Tresvant
Kamis, 2026-01-15 00:50:29

hatte er hauptsächlich in den USA Erfolg. Sein größter Solohit hieß Sensitivity und stieg Ende 1990 bis auf Platz 4 der US-Charts und Anfang 1991 auf...

Click to read more »
Mrs. Miniver
Minggu, 2026-03-15 03:08:38

who have taken it gallantly. […] William Wyler has directed with a sensitivity that rarely shows in films. […] every one in the cast […] are excellent...

Click to read more »
TPHA
Rabu, 2022-12-28 17:45:20

S. 1016–1018, PMID 18080352. K. Manavi, H. Young, A. McMillan: The sensitivity of syphilis assays in detecting different stages of early syphilis. In:...

Click to read more »
SDS-PAGE
Minggu, 2026-01-11 01:53:10

with molecular masses 100,000–1000, and their detection with picomolar sensitivity. In: Electrophoresis. Band 12, Nummer 5, Mai 1991, S. 352–366, doi:10...

Click to read more »
Korallenmoos
Senin, 2026-01-26 04:22:51

officinalis (Coral Weed). In: Marine Life Information Network: Biology and Sensitivity Key Information Sub-programme (MarLIN). Abgerufen am 20. Mai 2008.  Hayward...

Click to read more »
Anti-Jo1-Antikörper
Minggu, 2025-07-27 22:50:40

of antinuclear autoantibodies of defined specificities. I. Precision, sensitivity, and specificity. In: Arthritis & Rheumatism. Band 42, Nr. 3, 1999, S...

Click to read more »
Archaeoglobus
Rabu, 2025-11-26 14:22:09

Thermococcus kodakaraensis Affects CO2/O2 Substrate Specificity and Oxygen Sensitivity. In: PLOS ONE 18. September 2015; doi:10.1371/journal.pone.0138351,...

Click to read more »
Methanhydrat
Selasa, 2026-06-23 15:57:30

Petroleum & Coal, 56, 4, 2014, S. 407–417. Pezhman Kazemi, Roya Hamidi: Sensitivity Analysis of a Natural Gas Triethylene Glycol Dehydration Plant in Persian...

Click to read more »
Gozintograph
Rabu, 2026-01-21 12:26:50

set graphs. In: Tomas Gal, Harvey J. Greenberg (Hrsg.): Advances in sensitivity analysis and parametric programming. (= International Series in Operations...

Click to read more »
Corona-Test
Sabtu, 2026-02-21 18:20:00

[abgerufen am 28. Dezember 2020]).  Chantal B.F. Vogels et al.: Analytical sensitivity and efficiency comparisons of SARS-COV-2 qRT-PCR primer-probe sets. medRxiv...

Click to read more »
Helminthen-Therapie
Kamis, 2026-06-25 03:09:07

the Human Hookworm Necator Americanus: Evaluating Immunity and Gluten-sensitivity - Full Text View - ClinicalTrials.gov. Abgerufen am 12. April 2022 (englisch)...

Click to read more »
Isomere des Piperins
Jumat, 2026-03-13 14:29:02

the Derivatives in Long Pepper Extract by HPLC Using Relative Molar Sensitivity. In: Food Hygiene and Safety Science (Shokuhin Eiseigaku Zasshi). Band 60...

Click to read more »
Dreikantröhrenwurm
Sabtu, 2026-01-24 19:30:32

Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...

Click to read more »
Christina Hopfe
Jumat, 2023-12-08 22:30:15

energy buildings, Routledge, ISBN 9781315726434, doi Uncertainty and sensitivity analysis in building performance simulation for decision support and...

Click to read more »
De-novo-Synthese
Sabtu, 2025-01-11 04:34:56

activation of AMPK and results in improved glucose handling and insulin sensitivity. In: Journal of diabetes and metabolic disorders. Band 13, 2014, S. 51...

Click to read more »
Babatisee
Minggu, 2025-05-04 23:02:48

Jerker Jarsjö: Water Balance and Level Change of Lake Babati, Tanzania: Sensitivity to Hydroclimatic Forcings. (PDF) 5. Dezember 2016, S. 3–4, abgerufen...

Click to read more »
Ortho- und Parawasserstoff
Senin, 2025-01-20 03:09:54

In: Z. Naturforsch. Nr. 34a, 1979, S. 163–166. Clifford R. Bowers: Sensitivity Enhancement Utilizing Parahydrogen. In: eMagRes. John Wiley & Sons, Ltd...

Click to read more »
Henrik Svensmark
Kamis, 2026-07-02 14:29:31

Zhang, 2021: The Earth’s Energy Budget, Climate Feedbacks, and Climate Sensitivity. In Climate Change 2021: The Physical Science Basis. Contribution of...

Click to read more »
Clutter (Radar)
Senin, 2026-03-02 19:46:46

sind deshalb sehr schwer zu unterdrücken. In der Praxis wird meist eine Sensitivity Time Control (STC) genutzt, um die meist im Nahbereich auftretenden Störungen...

Click to read more »
Interkulturelle Kompetenz
Kamis, 2026-06-04 04:43:29

Milton J. Bennett: A developmental approach to training for intercultural sensitivity. In: International Journal of Intercultural Relations. Nr. 10, 1986,...

Click to read more »
Mario Szegedy
Selasa, 2026-01-06 06:07:35

Solved in Two Pages, Quanta Magazine, 25. Juli 2019. Hao Huang, Induced subgraphs of hypercubes and a proof of the Sensitivity Conjecture, Arxiv 2019....

Click to read more »
Anna von Rath
Senin, 2026-02-23 01:09:45

abgerufen am 19. März 2025.  10 terms related to race that require sensitivity in translation. Abgerufen am 19. März 2025 (englisch).  Übersetzer*innen...

Click to read more »
Weizenhalmfaser
Kamis, 2026-04-16 12:06:07

B. Otto, H. Viehoff et al.: Cereal Fiber Improves Whole-Body Insulin Sensitivity in Overweight and Obese Women. In: Diabetes Care. Band 29, Nr. 4, 2006...

Click to read more »
Nordische Purpurschnecke
Jumat, 2026-04-17 17:55:56

marlin.ac.uk. Marine Life Information Network: Biology and Sensitivity Key Information Sub-programme (on-line). Plymouth: Marine Biological...

Click to read more »
Strandseeigel
Sabtu, 2021-11-06 18:39:41

Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...

Click to read more »
Cinchonismus
Kamis, 2026-02-19 01:36:17

Heidelberg 1927 doi:10.1007/BF01863946 CD Calnan, GA Caron: Quinine Sensitivity. In: BMJ. 2. Jahrgang, Nr. 5269, 30. Dezember 1961, S. 1750–1752, doi:10...

Click to read more »
Canine Demodikose
Kamis, 2025-07-24 08:25:44

78 (2000), Heft 4, S. 240–242. M. N. Saridomichelakis u. a.: Relative sensitivity of hair pluckings and exudate microscopy for the diagnosis of canine...

Click to read more »
Eiskeil
Senin, 2025-11-03 22:57:48

B. T. Werner: Nonlinear dynamics of ice-wedge networks and resulting sensitivity. In: Nature. Band 417, 2002, S. 929–932. ( online (Memento vom 18. Oktober...

Click to read more »
Hanns Hatt
Minggu, 2026-07-05 15:40:04

Wellerdieck, M. Kuczkowiak, G. Gisselmann, H. Hatt: Specificity and sensitivity of a human olfactory receptor functionally expressed in human embryonic...

Click to read more »
Toll-like-Rezeptoren
Selasa, 2025-11-11 21:32:56

in cellular subsets of human peripheral blood mononuclear cells and sensitivity to CpG oligodeoxynucleotides. In: Journal of Immunology. Band 168, Nr...

Click to read more »
24 Nights
Sabtu, 2026-07-04 01:02:14

that I am a Gianni Versace fanatic... His approach to design and his sensitivity to colour appeal to the dormant artist in me and somehow I feel that...

Click to read more »
Steven Reiss
Sabtu, 2024-11-23 06:53:43

Steven Reiss, Rolf A Peterson, David M Gursky, Richard J McNally: Anxiety sensitivity, anxiety frequency and the prediction of fearfulness. In: Behaviour Research...

Click to read more »
Trapped Ion Mobility Spectrometry
Minggu, 2026-01-11 18:24:54

Accumulation–Serial Fragmentation (PASEF): Multiplying Sequencing Speed and Sensitivity by Synchronized Scans in a Trapped Ion Mobility Device. In: Journal of...

Click to read more »
Landomycine
Sabtu, 2024-11-09 01:46:40

7164/antibiotics.43.492. O. V. Tymchyk, B. P. Matseliukh, V. I. Lavrinchuk: Sensitivity of Streptomyces globisporus 3-1–a highly active producer of landomycin...

Click to read more »
Chic/Diskografie
Minggu, 2026-04-05 18:13:10

Johnson feat. Chic Remixe von T Smoove, Gianni Bini und Paolo Martini 2006 Sensitivity Sound Advice — — — UK40 (3 Wo.)UK — — — Erstveröffentlichung: Juli 2006...

Click to read more »
Langschnäuziges Seepferdchen
Selasa, 2025-11-25 01:36:54

Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...

Click to read more »
Isotopentrennung
Rabu, 2026-04-15 04:11:46

Joseph A. Berry: Carbon isotopes and water use efficiency: sense and sensitivity. In: Oecologia. Band 155, Nr. 3, 2008, S. 441–454, doi:10.1007/s00442-007-0932-7...

Click to read more »
Differential Privacy
Sabtu, 2025-04-05 23:18:02

Dwork, Frank McSherry, Kobbi Nissim, Adam Smith: Calibrating Noise to Sensitivity in Private Data Analysis. In: Shai Halevi, Tal Rabin (Hrsg.): Theory...

Click to read more »
Einstein-Teleskop
Senin, 2026-07-13 03:31:12

www.et-gw.eu, 14 June 2022. Stefan Hild et al.: Pushing towards the ET sensitivity using ‘conventional’ technology. 24. November 2008, arxiv:0810.0604,...

Click to read more »
Alexander Shapiro
Sabtu, 2025-08-09 17:23:21

Programming, Reihe A. mit R. Y. Rubinstein: Discrete event systems: Sensitivity analysis and stochastic optimization by the score function method, Wiley...

Click to read more »
Topo-optische Reaktion
Kamis, 2025-11-27 20:46:05

doi:10.1016/j.acthis.2006.01.002, PMID 16542712. M. Bély, J. Makovitzky: Sensitivity and specificity of Congo red staining according to Romhányi. Comparison...

Click to read more »
TKX-50
Minggu, 2026-01-25 17:17:00

1016/j.jhazmat.2017.05.040.  Dilip Badgujar, Mahadev Talawar: Thermal and Sensitivity Study of Dihydroxyl Ammonium 5,5′-Bistetrazole-1,1′-diolate (TKX-50)-based...

Click to read more »
Zirkoniumnitrid-Multilayerbeschichtung
Senin, 2020-12-21 00:26:41

32(1), 2003 Jan, S. 60–64. N. Hallab, K. Merritt, J. J. Jacobs: Metal sensitivity in patients with orthopedic implants. In: J Bone Joint Surg Am. 83-A(3)...

Click to read more »
Jens Claus Brüning
Sabtu, 2026-02-14 10:41:41

Steculorum, Jens C. Brüning: Neuronal control of peripheral insulin sensitivity and glucose metabolism. In: Nature Communications. Band 8, Nr. 1, 4. Mai...

Click to read more »
Gefingerte Klettenholothurie
Senin, 2019-07-29 20:34:06

Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...

Click to read more »
Milzbrandtoxin
Jumat, 2026-04-17 17:23:02

S. I. Candille u. a.: Human genetic variation altering anthrax toxin sensitivity. In: Proceedings of the National Academy of Sciences. Band 109, Nummer...

Click to read more »
Liste von Audio-Fachbegriffen
Selasa, 2026-08-11 14:05:26

Gerät ausgelegt ist. Übertragungsfaktor – die Empfindlichkeit (engl.: Sensitivity), mit welcher der ↑ Schalldruck von Mikrofonen in elektrische Signalspannung...

Click to read more »
Versfest berlin
Sabtu, 2026-04-18 03:49:21

delight, because it deals with issues of growing up, like identity and the desire to fit in, with depth and sensitivity and in utterly beautiful verse.«...

Click to read more »
Stefan Pieh
Jumat, 2025-08-15 20:15:59

Grechenig, H. Weghaupt, C. Vass und C. Skorpik: Tritan colour contrast sensitivity function in refractive multifocal intraocular lenses. In: British Journal...

Click to read more »
Erna Möller
Senin, 2024-12-16 15:54:06

Akademie der Wissenschaften mit G. Möller: Quantitative studies of the sensitivity of normal and neoplastic mouse cells to the cytotoxic action of isoantibodies...

Click to read more »
Paratyphus
Minggu, 2026-01-04 17:09:26

Pitzer: The Relationship Between Blood Sample Volume and Diagnostic Sensitivity of Blood Culture for Typhoid and Paratyphoid Fever: A Systematic Review...

Click to read more »
Baboon-Syndrom
Rabu, 2025-11-05 23:21:06

8917837. L. Fernandez, E. Maquiera u. a.: Baboon syndrome due to mercury sensitivity. In: Contact Dermatitis. Band 33, Nummer 1, Juli 1995, S. 56–57, PMID...

Click to read more »
ADMX-Experiment
Sabtu, 2025-02-01 23:39:41

Michael S. Turner, D. Moltz, J. Powell, N. Golubev: Results from a High-Sensitivity Search for Cosmic Axions. In: Physical Review Letters. Band 80, Nr. 10...

Click to read more »
Kontroverse um die globale Erwärmung
Sabtu, 2026-06-27 16:51:56

Using multiple observationally-based constraints to estimate climate sensitivity, Entwurf vom 30. Januar (PDF; 140 kB) (Memento vom 8. Juli 2011 im Internet...

Click to read more »
Elektrische Impedanz-Tomografie
Selasa, 2025-08-19 21:49:00

1137–1154. C. W. Piccoli: Contrast-enhanced breast MRI: factors affecting sensitivity and specificity. In: Eur. Radiol. 7 Suppl 5, 1997, S. 281–288. P. H....

Click to read more »
Jimmy Ruffin
Rabu, 2026-01-14 21:01:16

17 eine EP ein und sang dabei die Stücke A Foolish Thing to Do und My Sensitivity. 1989 veröffentlichte er mit Brenda Holloway die das Duett On the Rebound...

Click to read more »
Theoretische Sättigung
Minggu, 2022-11-20 22:05:03

Hopf/Weingarten: Qualitative Sozialforschung (1979). Barney G. Glaser: Theoretical Sensitivity. Advances in the Methodology of Grounded Theory (1978). Anselm L. Strauss;...

Click to read more »
Bernhard Ludvik
Rabu, 2024-12-04 01:55:55

Influence of metabolic control on splanchnic glucose uptake, insulin sensitivity, and the time required for glucose absorption in patients with type 1...

Click to read more »
James Martin (Theologe)
Minggu, 2026-03-15 23:57:09

Community Can Enter into a Relationship of Respect, Compassion, and Sensitivity (Harper One, 2017). How Can I Find God? The Famous and Not-So-Famous...

Click to read more »
Populationsgefährdungsanalyse
Senin, 2024-09-23 06:13:01

Robert C. Lacy und Sherwin WB (2018). Applicability and limitations of sensitivity analyses for wildlife management. Journal of Applied Ecology 55, 1430–1440...

Click to read more »
Posthörnchenwurm
Kamis, 2020-05-14 17:34:16

Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...

Click to read more »
National Training Laboratory
Selasa, 2025-02-18 00:43:43

wurden durch Beobachtung und Selbsterfahrung (Selbsterfahrungs-Gruppe, Sensitivity-Gruppe) die sonst übliche Trennung von Lehre, Forschung und Lernen durchbrochen...

Click to read more »
Martin F. Fromm
Kamis, 2025-10-16 15:37:46

Jörg König, Peter Stopfer, Martin F. Fromm: A Metabolomic Analysis of Sensitivity and Specificity of 23 Previously Proposed Biomarkers for Renal Transporter‐Mediated...

Click to read more »
SARS-CoV-2-Variante Omikron
Minggu, 2026-05-24 22:31:20

does not appear to be impacted by Omicron; studies of the comparative sensitivity of Ag-RDTs are ongoing.“  SARS-CoV-2 Viral Mutations: Impact on COVID-19...

Click to read more »
Michael Roden
Kamis, 2026-04-30 20:34:20

Moser E, Roden M: Liver ATP synthesis is lower and relates to insulin sensitivity in patients with Type 2 Diabetes. In: Diabetes Care. Band 34, Nr. 2,...

Click to read more »
Proteinkinaseinhibitor
Senin, 2025-06-30 04:26:31

(freier Volltext). P. A. Jänne, N. Gray, J. Settleman: Factors underlying sensitivity of cancers to small-molecule kinase inhibitors. In: Nature Reviews Drug...

Click to read more »
Steven Sherwood
Sabtu, 2023-03-04 05:25:18

sensitivity traced to atmospheric convective mixing, Nature, Band 505, 2014, S. 37–42 mit S. Bony u. a.: Clouds, circulation and climate sensitivity,...

Click to read more »
Tasmanian Passage
Rabu, 2025-07-02 00:42:49

143–162 (2004) The influence of ocean gateways on climate. Numerical sensitivity studies on ocean circulation rearrangements. (PDF; 116 kB) Geophysical...

Click to read more »
Sarojini Sahoo
Jumat, 2026-07-17 13:51:50

Für diesen Blog erhielt sie bei den Laadli Media Awards for Gender Sensitivity 2010–11 die Auszeichnung für den besten englischsprachigen Blog. Bereits...

Click to read more »
Liste von DOS-Kommandozeilenbefehlen
Rabu, 2026-05-06 01:53:58

der 8.3-Konvention, wandelt Klein- in Großbuchstaben um (siehe Case sensitivity), löst auch den Joker * zu mehreren ? (z. B. *.ASM zu ????????.ASM) auf...

Click to read more »
Olympus-E-System
Rabu, 2023-11-08 18:40:48

@1@2Vorlage:Webachiv/IABot/olympus.de dpreview, Olympus E-30 review Olympus E-30 ISO Sensitivity / Noise levels Deutsche Olympus E-System-Webseite Offizielle Website...

Click to read more »
Scolelepis squamata
Kamis, 2020-05-14 18:20:15

Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...

Click to read more »
STS-9
Sabtu, 2026-07-04 19:46:09

1126/science.225.4658.226.  A. Cogoli, A. Tschopp und P. Fuchs-Bislin: Cell Sensitivity to Gravity. In: Science. Band 225, Nr. 4658, 13. Juli 1984, S. 228–230...

Click to read more »
Minderheitenstress
Selasa, 2026-08-11 15:45:10

gay men: An examination of internalized homonegativity and rejection sensitivity as potential mechanisms. In: Journal of Consulting and Clinical Psychology...

Click to read more »
Johan Auwerx
Rabu, 2026-07-01 03:28:36

decreased receptor activity, lower body mass index and improved insulin sensitivity, Nature Genetics, Band 20, 1998, S. 284–287 mit T. T. Lu u. a.: Molecular...

Click to read more »
Treibhaus Erde
Rabu, 2026-05-06 18:08:57

Rondanelli, Jens Olaf Pepke Pedersen: Deep time evidence for climate sensitivity increase with warming. In: Geophysical Research Letters. 43. Jahrgang...

Click to read more »
Homunculus (Gattung)
Minggu, 2025-10-12 23:52:09

Richard F. Kay und Matthew W. Colbert: Auditory Morphology and Hearing Sensitivity in Fossil New World Monkeys. The Anatomical Record 293, 2010, S. 1711–1721...

Click to read more »
ISO 5800
Minggu, 2024-12-22 00:20:11

ergeben. Die zugehörigen Empfindlichkeitsleitwerte Sv (engl. speed value / sensitivity) (auch als logarithmische ASA-Grad bekannt) unterstützen bei der Berechnung...

Click to read more »
6-Shogaol
Minggu, 2026-01-25 02:38:08

Products: Effects of Ionization Polarity and Mobile Phase Modifier on the Sensitivity. In: Journal of Food Science. Band 81, Nr. 10, Oktober 2016, PMID 27589022...

Click to read more »
Kurzschnäuziges Seepferdchen
Selasa, 2025-11-25 01:38:09

Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...

Click to read more »
Phytophthora cactorum
Senin, 2025-12-01 01:42:26

PMID 20222560. S. N. Hill, M. K. Hausbeck: Virulence and fungicide sensitivity of Phytophthora cactorum isolated from American ginseng gardens in Wisconsin...

Click to read more »
Polaritätselement
Senin, 2025-06-09 03:49:38

Linguistic Society. Band 11, 1975, S. 188–199.  William A. Ladusaw: Polarity Sensitivity as Inherent Scope Relations. 1979.  Anke von Bergen, Karl von Bergen:...

Click to read more »
Leroy Hood
Senin, 2026-02-09 01:58:12

Service to Society 2019 IRI Medal New Protein Sequenator with Increased Sensitivity. In: Science. Band 207, 1980, S. 523 (mit M. W. Hunkapiller) A Microchemical...

Click to read more »
Cadmiumwolframat
Minggu, 2026-01-25 00:42:37

Yurchenko: Further study of CdWO4 crystal scintillators as detectors for high sensitivity experiments: Scintillation properties and pulse-shape discrimination...

Click to read more »
Ulrike Lohmann
Selasa, 2026-04-07 02:05:19

Disentangling greenhouse warming and aerosol cooling to reveal Earth’s climate sensitivity. In: Nature Geoscience. Band 9, Nr. 4, 2016, S. 286. doi:10.1038/ngeo2670...

Click to read more »
Marisa Carrasco
Jumat, 2026-08-07 09:58:13

Epub 2001 Apr 17. Marisa Carrasco: Covert attention increases contrast sensitivity: psychophysical, neurophysiological and neuroimaging studies. In: Visual...

Click to read more »
Robert Tannenbaum
Sabtu, 2025-06-14 05:39:26

modernen Theorie der Kleingruppenprozesse, dem Sensitivitäts-Training (Sensitivity training) und T-Gruppen (T-groups) wesentliche Impulse. Tannenbaum beschrieb...

Click to read more »
HCN-Kanal
Jumat, 2026-04-24 12:34:18

Ludwig, F. Hofmann, M. Biel: A single histidine residue determines the pH sensitivity of the pacemaker channel HCN2. In: J Biol Chem. 276, 2001, S. 6313–6319...

Click to read more »
32P-Postlabeling
Kamis, 2023-01-05 04:00:56

Nachweisgrenze liegt bei 1 Addukt auf 1010 N. Ramesh C. Gupta: Enhanced Sensitivity of 32P-Postlabeling Analysis of Aromatic Carcinogen: DNA Adducts. in:...

Click to read more »
Grönländischer Eisschild
Minggu, 2026-07-05 13:01:03

Accelerating changes in ice mass within Greenland, and the ice sheet’s sensitivity to atmospheric forcing. In: PNAS. Band 116, Nr. 6, 22. Januar 2019, S...

Click to read more »
Zeitlosengewächse
Jumat, 2026-07-03 23:08:48

(Abschnitt Systematik) Juliana Chacón, Susanne S. Renner: Assessing model sensitivity in ancestral area reconstruction using Lagrange: A case study using the...

Click to read more »
Fenstermücken
Senin, 2025-09-08 12:15:01

Verlag, Stuttgart 1994. Norbert Israelewski: The relation of radiation sensitivity to pronuclear chromosome structure. I. Different radiation sensitivities...

Click to read more »
Fampridin
Sabtu, 2026-01-24 15:58:02

M. J. Monteiro, J. Z. Yeh, C. T. Bever: Inactivation gating and 4-AP sensitivity in human brain Kv1.4 potassium channel. In: Brain Res. Nr. 831, 1999...

Click to read more »
Crangon allmanni
Sabtu, 2025-03-08 06:10:45

Crangon allmanni. A shrimp. Marine Life Information Network: Biology and Sensitivity Key Information Sub-programme, 2009. (Online) Crangon allmani im Marine...

Click to read more »
Central Great Plains
Minggu, 2024-12-08 18:43:29

K. Lauenroth et al.: Regional Analysis of the Central Great Plains: Sensitivity to Climate Variability. In: BioScience, Band 41, Nummer 10, November...

Click to read more »
Markus Reichstein
Senin, 2026-01-26 05:48:15

Montagnani, A. D. Richardson: Global Convergence in the Temperature Sensitivity of Respiration at Ecosystem Level. In: Science. Band 329, 2010, S. 838–840...

Click to read more »
Sideway Look
Senin, 2026-05-25 16:05:55

steer a slightly derivative course somewhere between Aztec Camera’s sensitivity and Big Country’s grandeur, with a touch of Simple Minds.“ (Ira A. Robbins)...

Click to read more »
Gozinto-Verfahren
Senin, 2024-01-08 13:50:07

set graphs. In: Tomas Gal, Harvey J. Greenberg (Hrsg.): Advances in sensitivity analysis and parametric programming. (= International Series in Operations...

Click to read more »
Oligomycin A
Rabu, 2026-04-22 13:46:39

oxidative phosphorylation. 8. Properties of a factor conferring oligomycin sensitivity on mitochondrial adenosine triphosphatase. In: The Journal of Biological...

Click to read more »
Susanne Cook-Greuter
Selasa, 2026-06-30 07:28:59

Lynam, Steven Schapiro: Development Of Ego Stages And Intercultural Sensitivity Through Doctoral Study. Fielding Graduate University, USA, [2] Sharon...

Click to read more »
Kalorienrestriktion
Senin, 2026-03-30 01:27:31

: Effect of calorie restriction with or without exercise on insulin sensitivity, beta-cell function, fat cell size, and ectopic lipid in overweight subjects...

Click to read more »
ANSI music
Rabu, 2025-12-03 22:04:17

vor dem Musikteil und ←[u ←[a ←[0m danach. Der englische Begriff case sensitivity beschreibt, wie ein System mit Groß- und Kleinschreibung umgeht. DOS...

Click to read more »
Gisela Trommsdorff
Kamis, 2026-01-22 21:01:37

mit J. Ziehm, T. Heikamp und S. Y. Park: German and Korean mothers' sensitivity and related parenting beliefs. In: Frontiers in Psychology. Band 4, 2013...

Click to read more »
Simnia patula
Minggu, 2021-07-25 20:08:39

Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network: Biology and Sensitivity Key Information Reviews, Marine Biological Association of the United...

Click to read more »
2020
Jumat, 2026-07-24 04:02:34

Gregory J. Hakim, Christopher J. Poulsen: Glacial cooling and climate sensitivity revisited. In: Nature. 584. Jahrgang, Nr. 7822, August 2020, ISSN 1476-4687...

Click to read more »
European Social Work Research Association
Rabu, 2025-05-28 17:52:28

1989: East-West Exchanges Between Universal Principles and Cultural Sensitivity“, Springer 2020, ISBN 978-3030458102, S. 94 ESWRA Award auf ESWRA-Webseite...

Click to read more »
Förster-Resonanzenergietransfer
Sabtu, 2026-04-25 19:02:04

11999692 (englisch).  Mekler VM: A photochemical technique to enhance sensitivity of detection of fluorescence resonance energy transfer. In: Photochem...

Click to read more »
Paläoklimatologie
Sabtu, 2026-06-27 01:37:31

Rondanelli, Jens Olaf Pepke Pedersen: Deep time evidence for climate sensitivity increase with warming. In: Geophysical Research Letters. Band 43, Nr...

Click to read more »
Tiergift
Senin, 2026-02-16 04:43:19

D. Valentine, Lawrence M. Lichtenstein: Epidemiology of insect venom sensitivity. In: JAMA. 262, Nr. 2, 1989, S. 240–244, doi:10.1001/jama.1989.03430020082033...

Click to read more »
Ozeanzirkulation
Selasa, 2026-01-06 22:49:52

Remote Influences on the Heat Content of the Labrador Sea: An Adjoint Sensitivity Study. In: JGR Oceans, Band 123, Ausgabe 4, S. 2646–2667. DOI:10.1002/2018JC013774...

Click to read more »
Taro Takahashi
Jumat, 2025-11-28 22:08:21

geehrt. James E. Hansen und Taro Takahashi: Climate Processes and Climate Sensitivity. In: Geophysical Monograph. Band 29, Nr. 5. American Geophysical Union...

Click to read more »
Silke Biermann
Sabtu, 2026-02-14 18:03:52

 a.: Bandwidth and Fermi surface of iron oxypnictides: Covalency and sensitivity to structural changes, Phys. Rev. B, Band 78, 2008, S. 064518 mit M....

Click to read more »
Luciobarbus microcephalus
Kamis, 2024-04-04 15:41:28

Clavero, F. Blanco-Garrido und J.Prenda (2009): Assessing freshwater fish sensitivity to different sources of perturbation in a Mediterranean basin. Ecology...

Click to read more »
Simone Tilmes
Kamis, 2026-01-01 16:59:42

begutachtete Beiträge, darunter: mit Rolf Müller, Ross Salawitch: The sensitivity of polar ozone depletion to proposed geoengineering schemes. In: Science...

Click to read more »
Suyoen Kim
Sabtu, 2025-12-13 00:39:57

dispatches its pyrotechnics with ease, and weaves its melodies with sensitivity and assurance. The “Concerto funèbre”, also of its time, is much darker...

Click to read more »
CLOUD-Experiment
Rabu, 2026-08-12 12:47:35

Zhang, 2021: The Earth’s Energy Budget, Climate Feedbacks, and Climate Sensitivity. In Climate Change 2021: The Physical Science Basis. Contribution of...

Click to read more »
Sepiola rondeletii
Senin, 2025-10-20 11:37:21

Sepiola rondeletii. In: Marine Life Information Network: Biology and Sensitivity Key Information Reviews. H. Tyler-Walters, K. Hiscook, 6. November 2011...

Click to read more »
World3
Rabu, 2024-11-13 22:30:28

Crescenzi, Giorgio Gambosi, Lucia Nasti, Aurora Rossi, Emanuele Natale: A sensitivity analysis of the Earth for all model: Getting the giant leap scenario...

Click to read more »
Interdependenztheoretischer Ansatz
Minggu, 2026-08-09 16:38:20

Sicherheitsinteressen, sondern insbesondere um internationale Wohlfahrt. „Sensitivity-Interdependenz“ (Sensibilität) besagt, dass Staaten zunehmend empfindlicher...

Click to read more »
Karl Otto Götz
Selasa, 2026-05-12 02:41:54

auch zu einem bis heute verwendeten visuellen Test (Visual-Aesthetic-Sensitivity-Test, kurz VAST) führten, veröffentlichten Götz und Rissa 1972 in ihrem...

Click to read more »
2,4-Dinitroanisol
Sabtu, 2026-01-24 18:51:35

Characterisation of 2,4-Dinitroanisole: An Ingredient for use in Low Sensitivity Melt Cast Formulations, 2006; PDF Datenblatt 2,4-Dinitroanisol bei Sigma-Aldrich...

Click to read more »
Brutfleck
Minggu, 2026-07-19 08:50:06

1990, S. 168.  Robert A. Hinde, R. Q. Bell, E. Steel: Changes in the sensitivity in the canary brood patch during the natural breeding season. In: Animal...

Click to read more »
Chemosensitivitätstest
Jumat, 2025-05-16 01:53:54

B. G. Durie, D. S. Alberts, T. E. Moon: Quantitation of differential sensitivity of human-tumor stem cells to anticancer drugs. In: The New England Journal...

Click to read more »
Störung der Blut-Hirn-Schranke
Minggu, 2025-05-11 17:57:20

monocytes to cross the blood-brain barrier into the brain and the in vivo sensitivity of the blood-brain barrier to disruption by lipopolysaccharide. In: J...

Click to read more »
Dieter T. Roth
Sabtu, 2022-07-02 13:22:57

2014, S. 371–96. Missionary Ethics in Q 10:2-12. In Kobus Kok et al.: Sensitivity to Outsiders: Exploring the Dynamic Relationship between Mission and...

Click to read more »
Bernd Meyer (Ökonom)
Kamis, 2025-06-19 23:06:42

Zika: Economic Policy Simulations with Global Interdependencies: A Sensitivity Analysis for Germany. In: Economic Systems Research. 19(1), 2007, pp...

Click to read more »
Baffinstrom
Rabu, 2026-04-15 13:15:04

(2017): Evolution of Baffin Bay water masses and transports in a numerical sensitivity experiment under enhanced Greenland melt. In: Atmosphere–Ocean. Band 55...

Click to read more »
Eric Van Stryland
Kamis, 2025-11-06 00:13:31

Zeitschrift).  M. Sheik-bahae, A. A. Said, E. W. Van Stryland: High-sensitivity, single-beam n2 measurements. In: Optics Letters. Band 14, Nr. 17, 1...

Click to read more »
Manfred M. Fichter
Rabu, 2026-05-06 12:57:02

Questionnaire (Munich ED-Quest) DSM-5/ICD-10: Validity, Reliability, Sensitivity to Change, and Norms. In: European Eating Disorder Review. Band 23, Nr...

Click to read more »
Angriff auf Zikim 2023
Rabu, 2025-12-17 06:14:03

(englisch).  Master Sgt. Ido Kaslasi, 23: A perfect mix of ‘roughness, sensitivity’. timesofisrael.com, abgerufen am 7. März 2025 (englisch).  Army says...

Click to read more »
Trier Social Stress Test
Jumat, 2025-10-17 23:25:09

D. H. Hellhammer: HPA axis reactivity and lymphocyte glucocorticoid sensitivity in fibromyalgia syndrome and chronic pelvic pain. In: Psychosom Med,...

Click to read more »
Quartärforschung
Selasa, 2026-06-09 15:21:26

Tigchelaar, Oliver Elison Timm, Andrey Ganopolski: Nonlinear climate sensitivity and its implications for future greenhouse warming. In: Science Advances...

Click to read more »
Sekundäre innertropische Konvergenz
Minggu, 2022-08-28 19:38:31

ISBN 3-14-100600-8, Karten 1 und 2, S. 128. Nathalie de Noblet et al.: Sensitivity of simulated Asian and African summer monsoons to orbitally induced variations...

Click to read more »
Pine-Island-Gletscher
Senin, 2026-08-03 03:04:40

J. Steig, Qinghua Ding, E. Povl Abrahamsen, Michael Schröder: Strong Sensitivity of Pine Island Ice-Shelf Melting to Climatic Variability. In: Science...

Click to read more »
Der junge Häuptling Winnetou
Senin, 2026-05-25 03:46:19

Sortiment. Dabei ziehen sie auch externe Fachberater zu Rate oder setzen „Sensitivity Reader“ ein, die unsere Titel kritisch auf den richtigen Umgang mit sensiblen...

Click to read more »
Zirkone des Hadaikums
Jumat, 2025-12-05 01:11:10

Band 23, 2013, S. 1484–1490.  T. Mark Harrison und Axel K. Schmitt: High sensitivity mapping of Ti distributions in Hadean zircons. In: Earth and Planetary...

Click to read more »
Martin Pall
Sabtu, 2024-10-19 23:38:15

illnesses" : disease paradigm for chronic fatigue syndrome, multiple chemical sensitivity, fibromyalgia, post-traumatic stress disorder, Gulf War syndrome, and...

Click to read more »
UDP-Glucose-4-Epimerase
Kamis, 2026-05-21 02:14:56

KL, Malmstrom K, Krieger M, Fridovich-Keil JL: Mediators of galactose sensitivity in UDP-galactose 4'-epimerase-impaired mammalian cells. In: J. Biol....

Click to read more »
Magnetic Particle Imaging
Kamis, 2026-02-12 05:38:31

Weizenecker, J. Borgert, B. Gleich: A simulation study on the resolution and sensitivity of magnetic particle imaging. In: Physics in Medicine and Biology. Band 52...

Click to read more »
Piotr Potworowski
Jumat, 2024-12-20 20:06:39

of our own day, but reveals an exquisite taste and the most delicate sensitivity qualities which are, perhaps, rather less characteristic of the present...

Click to read more »
Ruth Ella Moore
Selasa, 2024-05-07 18:00:39

18 (1): Article 2., 1938. mit M. S. Briscoe, Dewey E. Puckett: The Sensitivity to Antibiotics of Microorganisms Isolated from the Gut of "Blaberus caniifer"...

Click to read more »
Adam Davison Smith
Sabtu, 2026-07-04 01:25:50

Dwork, Frank McSherry, Kobbi Nissim, Adam Smith: Calibrating Noise to Sensitivity in Private Data Analysis. In: Shai Halevi, Tal Rabin (Hrsg.): Theory...

Click to read more »
Luria-Delbrück-Experiment
Jumat, 2020-11-20 13:50:12

Newcombe-Experiment Luria, S. E., Delbrück, M.: Mutations of bacteria from virus sensitivity to virus resistance. In: Genetics. Band 28, Nummer 6, November 1943,...

Click to read more »
Liste von Seen in Tansania
Selasa, 2026-05-12 18:09:50

Jerker Jarsjö: Water Balance and Level Change of Lake Babati, Tanzania: Sensitivity to Hydroclimatic Forcings. (PDF) 5. Dezember 2016, S. 3, abgerufen am...

Click to read more »
Anschlussmotivation
Selasa, 2024-04-16 09:52:12

basieren. Er nennt sie „affiliative tendency“ (Anschlusstendenz; R1) und „sensitivity to rejection“ (Sensibilität für Zurückweisung; R2). Die Fragebögen fordern...

Click to read more »
Schmerzempfinden von Tieren
Selasa, 2026-06-16 19:05:01

2003, S. 49–51.  OLG Düsseldorf, NStZ 1994, 43. Joan Dunayer: Fish: Sensitivity Beyond the Captor’s Grasp. In: The Animals’ Agenda. (Juli/August), 1991...

Click to read more »
Chip Scale Package
Rabu, 2025-09-17 21:35:35

com/documents/public/application-notes/an0878_methods_of_reducing_light_sensitivity_in_csp_packages.pdf https://ez.analog.com/power/w/documents/4803/photosensitiv...

Click to read more »
Einstein@Home
Senin, 2025-11-10 15:42:15

et al.: The Einstein@home gamma-ray pulsar survey I - search methods, sensitivity and discovery of new young gamma-ray pulsars, 2016, arxiv:1611.01015...

Click to read more »
SARS-CoV-2-Variante Delta
Rabu, 2026-05-27 13:21:17

s. a. doi:10.1101/2021.08.12.456173 Delphine Planas et al.: Reduced sensitivity of SARS-CoV-2 variant Delta to antibody neutralization. In: Nature. Vol...

Click to read more »
Martin Klingenspor
Selasa, 2026-03-17 21:00:55

(2005). M Klingenspor, H Niggemann, G Heldmaier: Modulation of leptin sensitivity by short photoperiod acclimation in the Djungarian hamster, Phodopus...

Click to read more »
Frostmusterboden
Senin, 2025-11-03 23:17:17

B. T. Werner: Nonlinear dynamics of ice-wedge networks and resulting sensitivity. In: Nature. Band 417, S. 929–932, 2002 (online (Memento vom 18. Oktober...

Click to read more »