Search Results: Sensitivity Time Control
Weiterleitung nach:
- Wikidata: Sensitivity Time Control (Q2271337)
Case sensitivity
Minggu, 2025-08-31 13:03:30Der englische Ausdruck case sensitivity bezeichnet in der elektronischen Datenverarbeitung allgemein die Art und Weise, in der eine Benutzerschnittstelle...
Click to read more »Hochsensibilität
Sabtu, 2026-07-25 02:53:25sensorischer Verarbeitungssensitivität (englisch: Sensory Processing Sensitivity SPS). Die basale Forschungstätigkeit zu dem als Persönlichkeitsdisposition...
Click to read more »Nicht-Zöliakie-Weizensensitivität
Jumat, 2025-10-10 00:21:36non-celiac wheat sensitivity (NCWS), synonym: Weizensensitivität, früher Nicht-Zöliakie-Glutensensitivität, englisch non-celiac gluten sensitivity (NCGS) oder...
Click to read more »Moisture Sensitivity Level
Kamis, 2024-06-20 23:43:49Der Moisture Sensitivity Level (MSL; deutsch „Feuchtigkeitsempfindlichkeitsschwellwert“) bezieht sich auf die Feuchteempfindlichkeit von Halbleiterbauelementen...
Click to read more »Radar
Senin, 2026-08-10 00:21:21werden von den Radargeräteherstellern in ihren Gerätedokumentationen Sensitivity Time Control (STC) oder Gain Time Control (GTC) genannt. Solche Schaltungen...
Click to read more »Reinforcement Sensitivity Theorie
Sabtu, 2024-09-21 20:10:57Die Reinforcement Sensitivity Theorie (RST) von Jeffrey Alan Gray ist eine Modifikation des Temperamentsmodells von Hans Jürgen Eysenck. Die Theorie unterteilt...
Click to read more »C4 (Sprengstoff)
Kamis, 2026-06-18 04:38:57Developments in Composition C-4: Towards an Alternate Binder and Reduced Sensitivity. BAE Systems OSI, abgerufen am 3. Mai 2019 (englisch). Whitesides JD...
Click to read more »Multiple Chemikalien-Sensitivität
Kamis, 2026-06-18 17:38:05Chemikalienunverträglichkeit (abgekürzt MCS von englisch Multiple Chemical Sensitivity), auch idiopathische Umweltintoleranz oder idiopathische Umwelt-Unverträglichkeit...
Click to read more »HFS Plus
Kamis, 2025-06-12 11:25:49Kleinschreibung bei Pfad- und Dateinamen, was auch als englisch Case sensitivity bezeichnet wird. Für diese auch als HFSX bezeichnete Variante wird eine...
Click to read more »Reitstellung
Jumat, 2026-06-12 00:30:12PMC 28302 (freier Volltext). H. Alzate, M. L. Londono: Vaginal erotic sensitivity. In: J Sex Marital Ther. 10, 1984, S. 49–56. Karl Knörr, Henriette Knörr-Gärtner...
Click to read more »Ext4
Jumat, 2026-04-17 00:49:00Anzahl von Dateien per Verzeichnis erhöht (large_dir) ab Kernel 5.2: Case sensitivity kann nun optional ausgeschaltet werden (casefold) ab Kernel 5.4: Unterstützung...
Click to read more »Ext3
Minggu, 2025-08-31 13:26:08Dateisysteme, zwischen Groß- und Kleinschreibung unterscheidet (Case sensitivity), kann es bei der Nutzung unter Betriebssystemen welche Groß- und Kleinschreibung...
Click to read more »Blaue Nesselqualle
Minggu, 2025-02-09 20:55:39lamarckii. Blue jellyfish. In: Marine Life Information Network: Biology and Sensitivity Key Information Subprogramme, Plymouth: Marine Biological Association...
Click to read more »Gonorrhoe
Senin, 2026-08-10 01:58:13Epid. Bull. Nr. 9, März 2006 (rki.de [PDF]). Alice Reyn: Antibiotic sensitivity of gonococcal strains isolated in the South-East Asia and Western Pacific...
Click to read more »Klimasensitivität
Senin, 2025-12-29 16:45:13unterschieden zwischen Gleichgewichtsklimasensitivität (Equilibrium climate sensitivity – ECS) und transienter Klimaantwort (Transient climate response – TCR)...
Click to read more »Endorphine
Selasa, 2026-03-03 00:26:48reduces pressure pain sensitivity in humans without involvement of beta-endorphin(1-31), but does not reduce heat pain sensitivity. In: Neuroendocrinology...
Click to read more »Process Sensitivity Level
Jumat, 2013-11-29 01:36:28Der Process Sensitivity Level (PSL, englisch, dt. in etwa Prozessempfindlichkeitsklasse) beschreibt die Empfindlichkeit eines elektronischen Bauelements...
Click to read more »Gluten
Rabu, 2026-05-20 22:22:14No Effects of Gluten in Patients With Self-Reported Non-Celiac Gluten Sensitivity After Dietary Reduction of Fermentable, Poorly Absorbed, Short-Chain...
Click to read more »Grounded Theory
Jumat, 2026-08-07 09:34:21Theory. 2. Auflage. Sage, London 2014. Barney G. Glaser: Theoretical Sensitivity. Advances in the Methodology of Grounded Theory. Sociology Press, Mill...
Click to read more »Luftfeuchtigkeit
Rabu, 2026-07-08 06:26:47Weiterverarbeitung einer Trocknung (baking) unterzogen werden müssen, um Schäden beim Lötprozess zu vermeiden; Details unter Moisture Sensitivity Level...
Click to read more »Coitus a tergo
Selasa, 2026-05-12 01:15:24PMC 28302 (freier Volltext). H. Alzate, M. L. Londono: Vaginal erotic sensitivity. In: Journal of Sex & Marital Therapy. Band 10, 1984, S. 49–56. Jian...
Click to read more »Misophonie
Selasa, 2026-03-24 00:15:55Jastreboff geprägt. Ein häufig verwendetes Synonym ist selective sound sensitivity syndrome, auf Deutsch etwa „Selektives Geräuschempfindlichkeits-Syndrom“...
Click to read more »Sensitivitätsanalyse
Kamis, 2025-04-17 13:10:43Darstellung. Oldenbourg, München 1976, ISBN 3-486-34811-6 Assem Deif: Sensitivity Analysis in Linear Systems. Springer, Berlin 1986, ISBN 3-540-16312-3...
Click to read more »Insulinresistenz
Selasa, 2026-08-11 23:47:32M. J. Quon: Quantitative insulin sensitivity check index: a simple, accurate method for assessing insulin sensitivity in humans. In: J Clin Endocrinol...
Click to read more »Stechmücken
Minggu, 2026-08-09 11:17:29Allgeier, Carsten A. Brühl: Decreasing Bacillus thuringiensis israelensis sensitivity of Chironomus riparius larvae with age indicates potential environmental...
Click to read more »Bragard-Zeichen
Sabtu, 2023-09-02 05:14:45bei 67,42 %. Kaynoosh Homayouni, Seyedeh Halimeh Jafari, Hossein Yari: Sensitivity and Specificity of Modified Bragard Test in Patients With Lumbosacral...
Click to read more »Agar
Sabtu, 2026-05-23 03:32:43Scholz, Ralf Reski: Gelrite and agar differently influence cytokinin-sensitivity of a moss. In: Journal of Plant Physiology Bd. 146, 1995, S. 369–371...
Click to read more »Lepton
Sabtu, 2026-06-13 22:01:49Collaboration: Direct neutrino-mass measurement with sub-electronvolt sensitivity. In: Nature Physics. Band 18, Nr. 2, Februar 2022, ISSN 1745-2481, S...
Click to read more »Bella Hadid
Senin, 2026-08-03 10:04:42Oktober 2025 (englisch). Bella Hadid shocked and upset over 'lack of sensitivity' in Adidas campaign. 30. Juli 2024, abgerufen am 25. Oktober 2025 (britisches...
Click to read more »Oxycodon
Jumat, 2026-08-07 04:32:11Determined by Liquid Chromatography Combined With Tandem Mass Spectrometry: Sensitivity of the DRI Assay at 100 ng/ml Cut-Off and Validity of Semiquantitative...
Click to read more »MDR1-Defekt
Sabtu, 2025-03-01 20:11:10Rasseverteilung des MDR1-Defekts K. L. Mealey, S. A. Bentjen et al.: Ivermectin sensitivity in collies is associated with a deletion mutation of the mdr1 gene. In:...
Click to read more »Bildsensor
Jumat, 2025-12-26 14:14:47587–593 (upenn.edu [PDF]). Canon succeeds in developing world’s largest CMOS image sensor, with ultra-high sensitivity. Abgerufen am 25. Juni 2018...
Click to read more »Exekutive Dysfunktion
Senin, 2026-05-25 00:39:14C, Barrós A, Ortet G, Antònia Parcet M, Ibañez MI: Set-shifting and sensitivity to reward: A possible dopamine mechanism for explaining disinhibitory...
Click to read more »SPS
Minggu, 2025-02-23 02:45:20Paraplegiker-Stiftung Segmental progeroide Syndrome, siehe Progerie Sensory Processing Sensitivity, siehe Hochsensibilität Service de Presse Suisse, Kulturverein Sheppard...
Click to read more »PHQ-9
Minggu, 2026-03-15 21:19:02Gräfe: Measuring depression outcome with a brief self-report instrument: Sensitivity to change of the Patient Health Questionnaire (PHQ-9). In: J Affect Disord...
Click to read more »Amy Madigan
Selasa, 2026-03-17 01:12:47Lifeguard 2014: Shirin in Love 2014: Frontera 2016: Buried Child 2016: Sensitivity Training 2016: How to Get Away with Murder (Fernsehserie, Folge 3x02)...
Click to read more »Diethyltoluamid
Kamis, 2026-03-05 20:54:58doi:10.1073/pnas.0805312105. A natural polymorphism alters odour and DEET sensitivity in an insect odorant receptor. Nature 478, 511–514 (27. Oktober 2011);...
Click to read more »Angstsensitivität
Kamis, 2026-06-25 16:09:09gehören Anxiety Sensitivity Index (ASI), Anxiety Sensitivity Profile (ASP), Anxiety Sensitivity Index-Revised (ASI-R), Anxiety Sensitivity Index-3 (ASI-3)...
Click to read more »Propan
Selasa, 2026-08-11 01:58:43Watanabe (Japan): The Earth’s Energy Budget, Climate Feedbacks and Climate Sensitivity Supplementary Material. (PDF) In: IPCC. Abgerufen am 14. August 2024...
Click to read more »Klima
Selasa, 2026-06-09 16:31:53(englisch, Online [PDF]). Richard E. Zeebe: Time-dependent climate sensitivity and the legacy of anthropogenic greenhouse gas emissions. In: PNAS. Band 110...
Click to read more »Kennschalldruck
Selasa, 2023-03-07 16:27:44Messbedingungen und Messverfahren für Typprüfungen" Umrechnung von Kennschalldruckpegel und Wirkungsgrad bei passiven Lautsprechern (sensitivity)...
Click to read more »BSE Sensex
Selasa, 2026-08-11 12:57:54Der BSE Sensex (Bombay Stock Exchange Sensitivity Index) ist der bekannteste und wichtigste Aktienindex an der Bombay Stock Exchange (BSE) in Indien....
Click to read more »Empfindlichkeit (Technik)
Senin, 2022-04-04 23:20:43Die Empfindlichkeit (engl. sensitivity) ist in der Messtechnik definiert als die „Änderung des Wertes der Ausgangsgröße eines Messgerätes bezogen auf...
Click to read more »Propofol
Rabu, 2026-05-13 01:12:4822672847. F. Vaiano, F. Mari, F. P. Busardò, E. Bertol: Enhancing the sensitivity of the LC-MS/MS detection of propofol in urine and blood by azo-coupling...
Click to read more »Wo die wilden Kerle wohnen
Senin, 2025-11-17 08:39:52S. 60 (englisch). Mary Pols: Where the Wild Things Are: Sendak with Sensitivity. In: Time. Time Inc., 14. Oktober 2009, abgerufen am 14. März 2017 (englisch...
Click to read more »Magnetresonanztomographie
Jumat, 2026-05-22 23:46:51Acquisition Spin Echo Enhanced SE: Spin-Echo 90°–180°-Pulsfolge SENSE: Sensitivity-Encoded SMASH: Simultaneous Acquisition of Spatial Harmonics SPGR: Spoiled...
Click to read more »Wassernesselsucht
Rabu, 2025-02-19 02:15:55Walter B. Shelley, Howard M. Rawnsley: Aquagenic urticaria: Contact sensitivity to water. In: The Journal of the American Medical Association (JAMA)...
Click to read more »Miniature American Shepherd
Kamis, 2026-01-29 03:55:40und K.M. Meurs (2008): Breed distribution of the ABCB1-1Δ (multidrug sensitivity) polymorphism among dogs undergoing ABCB1 genotyping. JAVMA 233(6):921-4...
Click to read more »Preissensivität
Senin, 2024-03-25 18:45:38Ökonom Peter van Westendorp entwickelte 1976 ein Modell (englisch Price-Sensitivity-Meter) zur Feststellung der Zahlungsbereitschaft und Preissensitivität...
Click to read more »Eintagsfliegen
Sabtu, 2026-07-25 12:42:51Whiting (2003): The problem with ‘‘the Paleoptera Problem:’’ sense and sensitivity. Cladistics 19: S. 432–442. K. M. Kjer, F. L. Carle, J.Litman, J. Ware...
Click to read more »Borderline-Persönlichkeitsstörung
Selasa, 2026-07-14 16:11:22(Review). K. Staebler, E. Helbing, C. Rosenbach, B. Renneberg: Rejection sensitivity and borderline personality disorder. In: Clinical psychology & psychotherapy...
Click to read more »Mississippi-Alligator
Senin, 2024-11-18 18:35:34orientation and navigation of juvenile alligators: evidence of magnetic sensitivity. In: Journal of Comparative Physiology A. Band 154, Nr. 5, 1984, S. 649–658...
Click to read more »Narwal
Minggu, 2026-04-12 20:09:58Glenn: Extreme physiological adaptations as predictors of climate‐change sensitivity in the narwhal, Monodon monoceros. In: Marine Mammal Science, Band 27...
Click to read more »Klitoris
Kamis, 2026-07-30 14:34:18PMID 10600954, PMC 28302 (freier Volltext). Z. Hoch: Vaginal erotic sensitivity by sexological examination. In: Acta Obstetricia et Gynecologica Scandinavica...
Click to read more »Belichtungsindex
Rabu, 2026-05-06 19:07:41erzeugen, wird Standard-Ausgangsempfindlichkeit (englisch: standard output sensitivity (SOS)) genannt. In den Rohdaten einer fotografierten Rastergrafik werden...
Click to read more »Letzte Kaltzeit
Senin, 2026-08-10 10:09:34Gregory J. Hakim, Christopher J. Poulsen: Glacial cooling and climate sensitivity revisited. In: Nature. 584. Jahrgang, Nr. 7822, August 2020, ISSN 1476-4687...
Click to read more »MSL
Senin, 2025-07-28 22:07:22Scripting Language, Scriptsprache des IRC-Clients, siehe mIRC Moisture Sensitivity Level („Feuchtigkeitsempfindlichkeitsschwellwert“) in der Halbleitertechnik...
Click to read more »Sisi
Sabtu, 2024-08-10 00:00:07niederländische Getränkemarke SISI steht als Abkürzung für: Short Increment Sensitivity Index, Verfahren der subjektiven Audiometrie, siehe SISI-Test Siehe auch:...
Click to read more »Keratitis
Sabtu, 2025-11-29 05:37:24Héchard, Philippe Hartemann, Philippe Humeau, Marie-Cécile Trouilhé: Sensitivity of Vermamoeba (Hartmannella) vermiformis cysts to conventional disinfectants...
Click to read more »Pädophilie
Sabtu, 2026-03-14 22:53:15978-3-621-27614-6, S. 505–508. Kurt Freund, Robin J. Watson: Assessment of the sensitivity and specificity of a phallometric test: An update of phallometric diagnosis...
Click to read more »Feinfühligkeit
Kamis, 2025-06-05 06:45:52Feinfühligkeit ist ein durch Mary Ainsworth geprägter Begriff (engl. maternal sensitivity) aus der Psychologie frühkindlicher Bindungen und bezeichnet die Qualität...
Click to read more »Ataxie
Senin, 2026-08-03 15:11:45Grunewald, Marios Hadjivassiliou: Movement Disorders Related to Gluten Sensitivity: A Systematic Review. In: Nutrients. Band 10, Nr. 8, 8. August 2018,...
Click to read more »Blutzucker
Senin, 2026-08-10 04:04:21Synonyme, Übersetzungen Mark E. Daly u. a.: Acute effects on insulin sensitivity and diurnal metabolic profiles of a high-sucrose compared with a high...
Click to read more »Klimakatastrophe
Senin, 2026-03-30 03:44:22nature.com pik-potsdam.de (PDF; 515 kB) James Hansen u. a.: Climate sensitivity, sea level and atmospheric carbon dioxide. In: Royal Society Publishing...
Click to read more »Asperger-Syndrom
Selasa, 2026-08-11 14:47:36Kingsley Publishers, London 2007, ISBN 978-1-84642-559-2, 11. Sensory Sensitivity, S. 271 ff. Mandy Roy et al.: Das Asperger-Syndrom im Erwachsenenalter...
Click to read more »Barney G. Glaser
Senin, 2024-10-07 02:32:51Grounded-Theory-Methodologien. Darüber veröffentlichte er Theoretical Sensitivity (1978) und mehrere weitere Methodologien und Sammelbände zur Grounded...
Click to read more »Essig
Jumat, 2026-07-17 19:39:39Stability of SARS coronavirus in human specimens and environment and its sensitivity to heating and UV irradiation. Biomed Environ Sci. September 2003;16(3):...
Click to read more »Klimawandel
Kamis, 2026-07-16 22:51:47Hutchinson, Richard D. Pancost: Global mean surface temperature and climate sensitivity of the early Eocene Climatic Optimum (EECO), Paleocene–Eocene Thermal...
Click to read more »Morbus Cushing
Selasa, 2026-07-21 07:29:52Riebold et al.: A C-terminal HSP90 inhibitor restores glucocorticoid sensitivity and relieves a mouse allograft model of Cushing disease. In: Nature Medicine...
Click to read more »John Schlesinger
Selasa, 2025-09-16 20:09:33Camerimage 1996: Special Award Film Direction with a Special Visual Sensitivity Cinequest San Jose Film Festival 1998: Maverick Tribute Award David di...
Click to read more »Liste medizinischer Abkürzungen
Selasa, 2026-08-11 00:41:34Hereditäre Autosomal-rezessive primäre Mikrozephalie MCS Multiple Chemical Sensitivity Vielfache Chemikalienunverträglichkeit MCS Minimally conscious state...
Click to read more »Gammastrahlung
Rabu, 2026-06-24 14:12:27MAGIC Telescopes La Palma, Gamma-ray astronomy at low energies with high sensitivity Informationsschreiben der BG RCI (Memento vom 2. April 2015 im Internet...
Click to read more »Triazole
Selasa, 2025-11-18 14:44:00changes in the target P450 CYP51 enzyme associated with altered triazole-sensitivity in fungal pathogens of cereal crops. International Symposium on Cytochrome...
Click to read more »Dinkel
Kamis, 2026-08-06 00:26:14between Wheat and Spelt Bread in Patients with Suspected Non-Celiac Wheat Sensitivity. In: Nutrients. Band 14, Nr. 14, 7. Juli 2022, S. 2800, doi:10.3390/nu14142800...
Click to read more »Global Positioning System
Jumat, 2026-08-07 01:05:20Accelerating changes in ice mass within Greenland, and the ice sheet’s sensitivity to atmospheric forcing. In: Proceedings of the National Academy of Sciences...
Click to read more »Julia Monro
Sabtu, 2026-08-01 18:52:42verschiedenen medialen Kontexten tätig und begleitet regelmäßig Produktionen mit Sensitivity Reading. Sie war maßgeblich an der inhaltlichen Beratung für den Film...
Click to read more »Haferflocken
Jumat, 2026-04-17 02:30:15Li, Y. (2014). Effect of oat intake on glycaemic control and insulin sensitivity: A meta-analysis of randomised controlled trials. British Journal of...
Click to read more »John MacFarlane
Selasa, 2025-03-11 20:20:49Assessment sensitivity (unveröffentlicht): S. 78, online (PDF; 1,2 MB). Assessment sinsitivity (unveröffentlicht): S. 35–37. Assessment sensitivity (unveröffentlicht):...
Click to read more Ȇbertragungsfaktor
Jumat, 2025-09-05 06:20:48Übertragungsfaktor z. T. nicht in der SI-Einheit mV/Pa angegeben, sondern als sensitivity in dB bzw. in V o l t d y n / c m 2 , {\displaystyle \mathrm {\frac {Volt}{dyn/cm^{2}}}...
Click to read more »Sony Alpha 7S
Kamis, 2026-01-29 21:29:20April 2014 im Handel erhältlich ist. Die Bezeichnung S steht dabei für sensitivity, also die höhere Lichtempfindlichkeit des Sensors unter Verzicht auf...
Click to read more »Octafluornaphthalin
Minggu, 2026-01-25 02:59:49doi:10.1002/ejoc.200300570. Alexander B. Fialkov, Urs Steiner u. a.: Sensitivity and noise in GC–MS: Achieving low limits of detection for difficult analytes...
Click to read more »Ketamin
Kamis, 2026-08-06 22:19:06SM, Erreger K, Yuan H et al.: Subunit-specific mechanisms and proton sensitivity of NMDA receptor channel block. In: J Physiol. 581. Jahrgang, Pt 1, 2007...
Click to read more »Denatoniumbenzoat
Jumat, 2026-04-24 16:25:30Abgerufen am 8. April 2025 (deutsch). Matthew Gibbs u. a.: Bitter taste sensitivity in domestic dogs (Canis familiaris) and its relevance to bitter deterrents...
Click to read more »Training
Senin, 2026-06-15 16:02:44gruppendynamisches Laboratorium, Encounter-Gruppe, Gruppenpsychotherapie, Sensitivity Training); siehe auch National Training Laboratory (NTL). Das Jugendgerichtsgesetz...
Click to read more »Ovarialkarzinom
Senin, 2025-11-10 00:37:21Mucinous advanced epithelial ovarian carcinoma: clinical presentation and sensitivity to platinum-paclitaxel-based chemotherapy, the GINECO experience. In:...
Click to read more »Sony Alpha 7S II
Jumat, 2026-01-30 04:20:34klein. Die Bezeichnung S bezieht sich auf die höhere Empfindlichkeit (=sensitivity) der Kamerasensoren unter Verzicht auf höhere Auflösung. Diese Kamera...
Click to read more »Liste von Erdbeben auf Zypern
Jumat, 2025-05-30 20:34:03785–786 (google.com [abgerufen am 28. März 2023]). S. Yolsal, T. Taymaz: Sensitivity Analysis on Relations Between Earthquake Source Rupture Parameters and...
Click to read more »Kreatin
Rabu, 2026-08-12 19:15:07Phosphocreatine Circuit: Molecular and Cellular Physiology of Creatine Kinases, Sensitivity to Free Radicals, and Enhancement by Creatine Supplementation. In: Molecular...
Click to read more »Paranormal
Kamis, 2025-09-25 14:58:40Schofield, Ian S. Baker: Dissociative tendencies, sensory processing sensitivity and aberrant salience as predictors of anomalous experiences and paranormal...
Click to read more »Schleifenquantengravitation
Sabtu, 2026-02-21 18:48:01Cosmological Constant in LQG Vertex Amplitude G. Amelino-Camelia, Potential Sensitivity of Gamma-Ray Burster Observations to Wave Dispersion in Vacuo G. Amelino-Camelia...
Click to read more »Reint E. Gropp
Kamis, 2026-04-16 16:52:32Gropp: Spillover Effects among Financial Institutions: A State-Dependent Sensitivity Value-at-Risk Approach. In: Journal of Financial and Quantitative Analysis...
Click to read more »Paläozän/Eozän-Temperaturmaximum
Sabtu, 2026-06-27 01:34:11Hutchinson, Richard D. Pancost: Global mean surface temperature and climate sensitivity of the early Eocene Climatic Optimum (EECO), Paleocene–Eocene Thermal...
Click to read more »McNab
Minggu, 2025-05-11 17:51:53(Multidrug Sensitivity) und somit des MDR1-Defekts. K.L. Mealey und K.M. Meurs (2008): Breed distribution of the ABCB1-1Δ (multidrug sensitivity) polymorphism...
Click to read more »Bitterschokolade
Kamis, 2026-08-06 15:38:42administration of dark chocolate is followed by a significant increase in insulin sensitivity and a decrease in blood pressure in healthy persons. In: American Journal...
Click to read more »Fluide und kristalline Intelligenz
Rabu, 2026-02-25 19:48:13Strassberg: Validation of the Behavioral Dyscontrol Scale-Electronic Version: Sensitivity to subtle sequelae of mild traumatic brain injury. In: Brain Injury....
Click to read more »Katzenjunges
Rabu, 2026-02-25 00:42:05Michael J. Friedlander: Postnatal development of the spatial contrast sensitivity of X- and Y-cells in the kitten retinogeniculate pathway. In: Journal...
Click to read more »Schmerzschwelle
Senin, 2024-05-06 09:50:12Schmerzschwelle erfassen. Martin S. Angst, Nicholas G. Phillips u. a.: Pain sensitivity and opioid analgesia. A pharmacogenomic twin study. In: Pain, Band 153...
Click to read more »Kipptisch als Prüfverfahren
Rabu, 2026-08-05 13:46:37heart rate variability, blood pressure variability and baroreceptor sensitivity during rest and head-up tilt. In: Blood Pressure Monitoring. Band 10...
Click to read more »Ohr
Kamis, 2026-02-26 05:09:06(digitale-sammlungen.de). T. Aran Mooney et al.: Potential for Sound Sensitivity in Cephalopods. In: Arthur Popper, Anthony Hawkins (Hrsg.): The Effects...
Click to read more »Pornografiekonsum von Jugendlichen
Kamis, 2026-07-23 20:12:49Jonathan J. Wisco: The components of the adolescent brain and its unique sensitivity to sexually explicit material. In: Journal of Adolescence. Band 72, April...
Click to read more »Warmklima
Kamis, 2026-03-26 00:47:470812721106 (englisch, pnas.org). Richard E. Zeebe: Time-dependent climate sensitivity and the legacy of anthropogenic greenhouse gas emissions. In: pnas. 110...
Click to read more »Vulnerabilität
Kamis, 2026-04-09 18:23:11Verwundbarkeit als eine Funktion von Exposition (exposure), Sensitivität (sensitivity) und Anpassungsfähigkeit (adaptive capacity) verstanden: Exposition umfasst...
Click to read more »Oktanzahl
Sabtu, 2026-04-18 13:57:30Oktanzahl. Die Differenz zwischen ROZ und MOZ wird als „Empfindlichkeit“ (sensitivity) bezeichnet und bringt die Temperaturabhängigkeit der Oktanzahl zum Ausdruck...
Click to read more »Formaldehyd
Rabu, 2026-04-15 05:08:01D. J. Luecken, S. L. Napelenok, M. Strum, R. Scheffe, S. Phillips: Sensitivity of Ambient Atmospheric Formaldehyde and Ozone to Precursor Species and...
Click to read more »Volatilität
Jumat, 2025-12-05 20:14:25Schoelkopf, Nikoleta Tushteva: Long-Term Volatility Shapes the Stock Market's Sensitivity to News. In: Journal of Econometrics. 2023, ISSN 1556-5068, doi:10.1016/j...
Click to read more »Dateiname
Rabu, 2026-06-03 22:21:18veränderte Groß- und Kleinschreibung keinen Unterschied macht (keine case sensitivity). Die optionale Dateinamenserweiterung ist Teil des Dateinamens. Ein...
Click to read more »Chinazolin
Sabtu, 2026-01-24 06:18:07Yun: Structural and mechanistic underpinnings of the differential drug sensitivity of EGFR mutations in non-small cell lung cancer. In: Biochimica et Biophysica...
Click to read more »Ungeschminkt (Film)
Kamis, 2026-03-05 03:48:18von Dirk Kummer nach einem Drehbuch von Uli Brée vor der Kamera. Als Sensitivity-Beraterin fungierte Julia Monro. Premiere war am 5. Juli 2024 am Filmfest...
Click to read more »Lichtgeschwindigkeit
Rabu, 2026-06-17 21:26:08John Ellis, N. E. Mavromatos, D. V. Nanopoulos, Subir Sarkar: Potential Sensitivity of Gamma-Ray Burster Observations to Wave Dispersion in Vacuo. In: Nature...
Click to read more »Nonverbale Kommunikation
Senin, 2026-06-15 19:35:07Hall (1979): A cross-national study of gender differences in nonverbal sensitivity. Unveröffentlichtes Manuskript, Northeastern University, Boston (Massachusetts)...
Click to read more »Aufmerksamkeitsdefizit-/Hyperaktivitätsstörung
Sabtu, 2026-07-18 21:44:1416. Oktober 2015. N. Grizenko, R. M. Rodrigues Pereira, R. Joober: Sensitivity of scales to evaluate change in symptomatology with psychostimulants...
Click to read more »STC
Senin, 2021-07-12 18:59:21saudi-arabisches Telekommunikationsunternehmen Schenefelder TC, einen Tennisclub Sensitivity Time Control, eine Radarbaugruppe Short Time Constant, eine weitere Radarbaugruppe...
Click to read more »Zerebrale Amyloidangiopathie
Selasa, 2026-02-03 22:19:58Greenberg, J. P. Vonsattel: Diagnosis of cerebral amyloid angiopathy. Sensitivity and specificity of cortical biopsy. In: Stroke. 1997 Jul;28(7), S. 1418–1422...
Click to read more »Chemotherapie
Minggu, 2026-02-22 16:33:22H. Goldie, A. J. Coldman: A mathematic model for relating the drug sensitivity of tumors to their spontaneous mutation rate. In: Cancer Treat Rep. 63...
Click to read more »Dysurie
Jumat, 2026-07-10 03:40:30Urinary House Soiling (Periuria) in Cats and Its Differentiation: The Sensitivity and Specificity of Common Diagnostic Signs. In: Front Vet Sci 5, 2018...
Click to read more »Prompt-Engineering
Rabu, 2026-07-15 16:17:23leicht veränderten Formulierungen kann die Prompt-Sensitivity getestet werden. Bei hoher Prompt-Sensitivity sind die Resultate fraglich. Als Reflexion-Prompting...
Click to read more »Empathie
Minggu, 2026-08-09 03:45:132018 im Internet Archive)). J. A. Hall, F. J. Bernieri: Interpersonal Sensitivity, Theory and Measurement. London 2001, S. 21 f. und Paul Ekman: Gefühle...
Click to read more »Thees Uhlmann
Minggu, 2026-07-05 23:39:562006, ISBN 3-89602-697-6. Maren Volkmann: ‚Heulsusen-pop‘. New Male sensitivity in German independent music. In: Michael Ahlers, Christoph Jacke (Hrsg...
Click to read more »Diabetes mellitus
Senin, 2026-05-18 17:31:51S. 222–260, hier S. 240–241. Mark E. Daly: Acute effects on insulin sensitivity and diurnal metabolic profiles of a high-sucrose compared with a high...
Click to read more »ECS
Jumat, 2024-02-09 02:44:30Cushing-Syndrom, eine Pferdekrankheit Klimasensitivität (Equilibrium Climate Sensitivity, Gleichgewichts-Klimasensitivität) Erlangen Classification System, System...
Click to read more »Andreas Schmittner
Senin, 2026-04-20 01:41:05Nature Schmittner u. a. 2011, J. Climate Schmittner u. a.: Climate Sensitivity Estimated from Temperature Reconstructions of the Last Glacial Maximum...
Click to read more »Das Leben des Brian
Rabu, 2026-05-06 22:38:22Against, S 79. “[…] a disgraceful and distasteful assault on religious sensitivity.” Robert E. A. Lee, zitiert in Hewison, Monty Python: The Case Against...
Click to read more »Filmempfindlichkeit
Rabu, 2026-03-18 18:17:58jeweils mit einem Empfindlichkeitsleitwert Sv (englisch speed value / sensitivity) in Belichtungsstufen gemäß dem APEX-System. Der Standard der Internationalen...
Click to read more »E-Mail-Adresse
Kamis, 2025-06-26 12:35:54zwischen Groß- und Kleinschreibung unterschieden wird (englisch Case sensitivity), ist abhängig von der Interpretation durch die Domain des Empfängers...
Click to read more »Objektpermanenz
Rabu, 2025-03-26 00:15:29Topal, G. Gergely, A. Erdohegyi, G. Csibra, A. Miklosi: Differential Sensitivity to Human Communication in Dogs, Wolves, and Human Infants. In: Science...
Click to read more »Oberammergauer Passionsspiele
Rabu, 2026-01-28 21:42:23Die Deutsche Bühne, Heft Nr. 7/2000 (PDF; 589 kB) David Briggs: Out of sensitivity to Jews, changes made in Passion play, but 'blood curse' remains Tampa...
Click to read more »Cannabis als Rauschmittel
Senin, 2026-06-15 13:19:55studies examining the effects of cannabis use on motivation and reward sensitivity have yielded mixed findings. We conclude that cross-sectional evidence...
Click to read more »Golfstrom
Minggu, 2026-06-14 20:34:10general circulation model and application to Atlantic heat transport sensitivity. In: Journal of Geophysical Research 104 (1999), S. 29529-29547. DOI:...
Click to read more »Kollektivismus
Senin, 2026-07-27 02:46:02Nisbett: Attending holistically versus analytically: comparing the context sensitivity of Japanese and Americans. In: Journal of Personality and Social Psychology...
Click to read more »Malaienbär
Senin, 2026-06-08 17:32:04Taylor: Facial Complexity in Sun Bears: Exact Facial Mimicry and Social Sensitivity. In: Scientific Reports. Band 9, Nr. 1, 21. März 2019, ISSN 2045-2322...
Click to read more »Zöliakie
Senin, 2026-07-27 23:29:25Redefining the intraepithelial lymphocytes threshold to diagnose gluten sensitivity in patients with architecturally normal duodenal histology: Mild enteropathy...
Click to read more »Fettschwalm
Jumat, 2026-01-09 20:43:07The eyes of oilbirds (Steatornis caripensis): pushing at the limits of sensitivity. In: Naturwissenschaften. Band 91, Nr. 1, 2004, S. 26–29, doi:10.1007/s00114-003-0495-3...
Click to read more »Rebecca Bondü
Selasa, 2024-01-09 00:18:13Bilgin, R. Bondü, B. Elsner: Longitudinal associations between justice sensitivity, nonsuicidal self-injury, substance use, and victimization by peers....
Click to read more »Menschliche Geschlechtsunterschiede
Sabtu, 2026-07-25 12:38:42Lars Moller: mprisonment and women’s health: concerns about gender sensitivity, human rights and public health. In: Bulletin of the World Health Organization...
Click to read more »Katharina Seck
Rabu, 2026-07-15 17:03:20Phantastik-Literaturpreis Seraph ausgezeichnet. Katharina Seck ist außerdem als Sensitivity Readerin tätig und setzt sich aktiv für Gleichberechtigung, Inklusion...
Click to read more »Nocebo-Effekt
Jumat, 2026-08-07 17:26:59u. a.: A double-blind study of symptom provocation to determine food sensitivity. In: NEJM 323, 1990, S. 429–433. PMID 2374564. G. Liccardi u. a.: Evaluation...
Click to read more »Silken Windhound
Jumat, 2026-04-17 20:36:45KM. Meurs (2008): Breed distribution of the ABCB1-1Delta (multidrug sensitivity) polymorphism among dogs undergoing ABCB1 genotyping. In: JAVMA 233(6):921-4...
Click to read more »Hausstaubmilben
Senin, 2025-12-22 15:20:46Biagtan, R. Viswanathan, R. K. Bush: Immunotherapy for house dust mite sensitivity: where are the knowledge gaps? In: Current allergy and asthma reports...
Click to read more »Sehschärfe
Kamis, 2026-08-06 14:49:49Sabel: Assessing spatial vision – automated measurement of the contrast-sensitivity function in the hooded rat. In: Journal of Neuroscience Methods. Band 97...
Click to read more »Kurt Lewin
Kamis, 2026-05-07 09:06:46das Sensitivitätstraining oder die T(rainings)-Gruppe (engl. auch als sensitivity training group bezeichnet), die ein Grundmodell jeder Selbsthilfegruppe...
Click to read more »Narzisstische Persönlichkeitsstörung
Rabu, 2026-08-05 14:57:2876, Heft 4, 2008, S. 753–774; G. D. Atlas, M. A. Them: Narcissism and sensitivity to criticism: A preliminary investigation. In: Current Psychology. Band...
Click to read more »Pinatubo
Minggu, 2026-06-21 04:37:085194/acp-13-11221-2013. Tilmes, S., Müller, R., & Salawitch, R. (2008). The sensitivity of polar ozone depletion to proposed geoengineering schemes. Science...
Click to read more »Weibliche Genitalverstümmelung
Sabtu, 2026-06-27 16:58:09nach England, wo FGM zwar seit 1985 verboten ist, die Toleranz („ethnic sensitivity“) gegenüber dieser archaischen Tradition jedoch als größer eingeschätzt...
Click to read more »Periurie
Selasa, 2024-06-25 12:43:35Urinary House Soiling (Periuria) in Cats and Its Differentiation: The Sensitivity and Specificity of Common Diagnostic Signs. In: Front Vet Sci 5, 2018...
Click to read more »Liste von Erdbeben
Selasa, 2026-07-28 20:31:55Data Center, Boulder (Colorado) (englisch) Seda Yolsal, Tuncay Taymaz: Sensitivity Analysis on Relations Between Earthquake Source Rupture Parameters and...
Click to read more »Panikstörung
Kamis, 2026-07-23 16:38:56autofahrenohneangst.com N. B. Schmidt, M. J. Zvolensky, Maner JK: Anxiety sensitivity: Prospective prediction of panic attacks and Axis I pathology. In: Journal...
Click to read more »Känozoikum
Sabtu, 2026-06-27 01:30:32Hutchinson, Richard D. Pancost: Global mean surface temperature and climate sensitivity of the early Eocene Climatic Optimum (EECO), Paleocene–Eocene Thermal...
Click to read more »Basis Point Value
Minggu, 2026-04-26 02:20:03Gabler Banklexikon. Springer Gabler, abgerufen am 25. April 2026. Price Sensitivity (Basis Point Value). (PDF; 462 KB) ICE Futures Europe, 2014, abgerufen...
Click to read more »Pascal (Programmiersprache)
Selasa, 2026-07-14 15:16:49vereinigt. In C dürfen Funktionen nicht verschachtelt definiert werden. Case sensitivity Im Gegensatz zu C ist Pascal in Bezug auf Schlüsselwörter, Bezeichner...
Click to read more »Mikrowellenherd
Sabtu, 2026-07-11 02:44:17Abgerufen im 1. Januar 1 H. A. Kues, J. C. Monahan et al.: Increased sensitivity of the non-human primate eye to microwave radiation following ophthalmic...
Click to read more »Zirkumzision
Jumat, 2026-08-07 00:47:12T'Sjoen, R. Vlietinck, P. B. Hoebeke: Male circumcision decreases penile sensitivity as measured in a large cohort. In: BJU international. Band 111, Nummer...
Click to read more »Silibinin
Kamis, 2026-06-11 00:04:54Riebold et al.: A C-terminal HSP90 inhibitor restores glucocorticoid sensitivity and relieves a mouse allograft model of Cushing disease. In: Nature Medicine...
Click to read more »SARS-CoV-2
Senin, 2026-08-10 18:51:29Heinrich Scheiblauer, Angela Filomena, Andreas Nitsche et al.: Comparative sensitivity evaluation for 122 CE-marked rapid diagnostic tests for SARS-CoV-2 antigen...
Click to read more »Liposarkom
Minggu, 2025-12-14 00:37:4431, 2007, S. 1476–1489. PMID 17895748 R. L. Jones u. a.: Differential sensitivity of liposarcoma subtypes to chemotherapy. In: European Journal of Cancer...
Click to read more »Eiszeitalter
Senin, 2026-07-20 19:24:59abgerufen am 30. Oktober 2022]). Richard E. Zeebe: Time-dependent climate sensitivity and the legacy of anthropogenic greenhouse gas emissions. In: PNAS. 110...
Click to read more »Dispositionsindex
Minggu, 2026-05-10 14:04:46controlling glucose tolerance in man: measurement of insulin sensitivity and beta-cell glucose sensitivity from the response to intravenous glucose. In: The Journal...
Click to read more »Seemaus
Jumat, 2026-04-17 20:28:02Aphrodita aculeata. Sea mouse. Marine Life Information Network: Biology and Sensitivity Key Information Sub-programme, Plymouth: Marine Biological Association...
Click to read more »Narbe (Botanik)
Jumat, 2026-05-29 14:53:27S. 69. Xiao-Fang Jin, Zhong-Ming Ye, Grace M. Amboka et al.: Stigma Sensitivity and the Duration of Temporary Closure Are Affected by Pollinator Identity...
Click to read more »Septin-9-Test
Kamis, 2026-05-07 18:26:50Rahmani, JH. Haseman, GT. Lemmel, S. Kaster, JS. Buckley: Relative sensitivity of colonoscopy and barium enema for detection of colorectal cancer in...
Click to read more »Grottenolm
Jumat, 2026-07-17 17:59:00other cave-dwelling urodele species). Review and new results on light-sensitivity and non-visual orientation in subterranean urodeles (Amphibia). In: Animal...
Click to read more »Pestalotiopsis microspora
Sabtu, 2025-07-19 10:27:20November 2020. C.Q. Zhang, Y.H. Liu, H.M. Wu, B.C. Xu, P.L. Sun: Baseline sensitivity of Pestalotiopsis microspora, which causes black spot disease on Chinese...
Click to read more »Stickstoffmonoxid
Senin, 2026-07-27 01:08:01supplementation improves endothelial function and ameliorates insulin sensitivity and inflammation in cardiopathic nondiabetic patients after an aortocoronary...
Click to read more »Liebe und Anarchie (Fernsehserie)
Sabtu, 2025-12-27 18:50:05Publishing Jägerstedt Publishing Lisa Langseth Alex Haridi 11 3 Der Sensitivity Consultant Sensitivitetskonsulten Lisa Langseth Maria Nygren 12 4 Literatur...
Click to read more »Perfektionismus (Psychologie)
Jumat, 2026-05-29 13:33:41Orientations in Depression: an analysis of Validation seeking and rejection sensitivity in a Community sample of Young adults. 2014, PMID 24575914. Smith et...
Click to read more »Beck-Depressions-Inventar
Selasa, 2025-09-23 00:24:51M. Kojima, I. Yamamoto et al.: Gradations of clinical severity and sensitivity to change assessed with the Beck Depression Inventory-II in Japanese...
Click to read more »Logarithmische Normalverteilung
Minggu, 2025-01-26 16:26:46PMID 29071065, PMC 5639933 (freier Volltext). R A Romero, T B Sutton: Sensitivity of Mycosphaerella fijiensis, causal agent of black sigatoka of banana...
Click to read more »Western Blot
Kamis, 2026-05-28 00:01:33PMID 20206115. Fabrizio Gentile, Ernesto Bali, Giuseppe Pignalosa: Sensitivity and applications of the nondenaturing staining of proteins on polyvinylidene...
Click to read more »Intraokularlinse
Senin, 2026-01-05 01:27:53providing monofocal-like distance visual quality or provide contrast sensitivity that is significantly poorer than with monofocal IOLs.“ Joaquín Fernández...
Click to read more »Angela Merkel
Senin, 2026-07-20 01:51:25Spangenberg, T. Turanyi (1982): An Extended Kinetic Model and its Reduction by Sensitivity Analysis for the Methanol//Oxygen Gas-Phase Thermolysis. In: Acta Chimica...
Click to read more »Ozark-Plateau
Jumat, 2026-01-23 17:32:57Habitats in the Ozark Highlands of Missouri: Assessment of Physical Habitat Sensitivity to Environmental Change. United States Geological Survey – Biological...
Click to read more »Selbsterfahrung
Kamis, 2025-02-20 05:51:15Gruppendynamischen Trainings auf der Selbsterfahrung, spricht man von Sensitivity-Training, wo es verstärkt um Gespür, Feinfühligkeit, Einfühlungs- und...
Click to read more »Recruitment
Jumat, 2026-06-26 18:34:27Beispiele sind der Fowler-Test, der Lüscher-Test und der Short Increment Sensitivity Index (SISI-Test). Diese Tests haben durch Hirnstammaudiometrie (FAP...
Click to read more »Insulin
Selasa, 2026-07-14 14:10:53S. 4–10, hier: S. 4 und 7–8. Mark E Daly: Acute effects on insulin sensitivity and diurnal metabolic profiles of a high-sucrose compared with a high...
Click to read more »Weltraummüll
Minggu, 2026-07-12 17:10:18am 26. Februar 2021 (englisch). J.-C. Liou, Nicholas L. Johnson: A sensitivity study of the effectiveness of active debris removal in LEO. In: Acta...
Click to read more »Uğur Şahin
Jumat, 2026-07-17 02:57:422020]). Prof. Dr. med. Ugur Sahin. In: SFB 1399: Mechanisms of Drug Sensitivity and Resistance in Small Cell Lung Cancer. Department of Translational...
Click to read more »Mondrückseite
Sabtu, 2026-04-11 16:07:16frequency interference-free dedicated lunar far side crater for high sensitivity radioastronomy. Acta Astronautica, Vol. 46, Issue 8, 1. April 2000, S...
Click to read more »Verlustaversion
Selasa, 2026-06-02 15:13:27bildet das Prinzip der abnehmenden Sensitivität (englisch diminishing sensitivity) ab. Da die Wertfunktion im Verlustbereich steiler als im Gewinnbereich...
Click to read more »Tetrahydrocannabinol
Jumat, 2026-05-15 14:52:3115;852:158457, PMID 36063955. Sandra B. Grauwiler, Jürgen Drewe, André Scholer: Sensitivity and Specificity of Urinary Cannabinoid Detection with Two Immunoassays...
Click to read more »Schweigestrafe
Selasa, 2026-07-28 00:33:33Clarkin: A Multisurface Interpersonal Circumplex Assessment of Rejection Sensitivity. In: Journal of Personality Assessment. 99. Jahrgang, Nr. 1, 2. Januar...
Click to read more »Wüstengoldmull
Rabu, 2024-07-31 22:13:28(2), 2006, S. 1260–1268 Matthew J. Mason und Peter M. Narins: Seismic sensitivity in the Desert golden mole (Eremitalpa granti): A review. Journal of Comparative...
Click to read more »Titan(IV)-oxid
Minggu, 2026-07-26 19:34:52Ralf Schulz, Elena A. Rozhkova: Titanium Dioxide Nanoparticles Increase Sensitivity in the Next Generation of the Water Flea Daphnia magna. In: PLoS ONE...
Click to read more »Elizabeth (Film)
Senin, 2026-04-27 19:15:34[…] Kapur’s direction has a lavish, sinister energy, tempered by a sensitivity to the potential silliness of a film which puts a legion of British character...
Click to read more »Silken Windsprite
Jumat, 2026-04-17 20:36:46KM. Meurs (2008): Breed distribution of the ABCB1-1Delta (multidrug sensitivity) polymorphism among dogs undergoing ABCB1 genotyping. In: JAVMA 233(6):921-4...
Click to read more »Glyphosat
Rabu, 2026-07-01 02:47:38eja.2009.06.004. Tuomas Tall, Pere Puigbò: Rethinking the Intrinsic Sensitivity of Fungi to Glyphosate. In: Biotech (Basel (Switzerland)). Band 11, Nr...
Click to read more »Elaine Aron
Kamis, 2024-07-25 22:18:23heute als Pionierin gilt, und prägte den Begriff Sensory Processing Sensitivity (SPS). Nach einer Operation 1987, die sie emotional aufwühlte, wurde...
Click to read more »Sony Alpha 7S III
Kamis, 2026-01-29 22:17:22klein. Die Bezeichnung S bezieht sich auf die höhere Empfindlichkeit (sensitivity) der Kamerasensoren unter Verzicht auf höhere Auflösung. Diese Kamera...
Click to read more »Kultivierung
Selasa, 2026-07-14 15:34:05Scholz, Ralf Reski: Gelrite and agar differently influence cytokinin-sensitivity of a moss. In: Journal of Plant Physiology. Bd. 146, 1995, S. 369–371...
Click to read more »Schwefel
Senin, 2026-07-20 20:00:54Internet Archive) Tilmes, S., Müller, R., & Salawitch, R. (2008). The sensitivity of polar ozone depletion to proposed geoengineering schemes. Science...
Click to read more »Aldehyd-Dehydrogenasen
Minggu, 2024-07-28 21:30:25pyridoxin-dependent. In: Online Mendelian Inheritance in Man. (englisch). Alcohol sensitivity. In: Online Mendelian Inheritance in Man. (englisch)....
Click to read more »Gottkomplex
Rabu, 2026-04-22 14:41:49123 (englisch, google.com). Kaplan, Harold I.; Benjamin J. Sadock: Sensitivity through encounter and marathon. In: Modern Group Book. Band 4. J. Aronson...
Click to read more »Lautsprecher
Selasa, 2026-08-11 19:54:00Unterscheidet Kennschalldruckpegel und Wirkungsgrad bei passiven Lautsprechern (sensitivity & efficiency) Visaton SC 5 Fostex FW800HS SMSG50 von Ascendo mit Sitz...
Click to read more »Michael Bevis
Sabtu, 2024-08-24 18:27:53Accelerating changes in ice mass within Greenland, and the ice sheet’s sensitivity to atmospheric forcing. Proceedings of the National Academy of Sciences...
Click to read more »Matlab
Selasa, 2026-06-02 15:35:21Arrays. MathWorks, abgerufen am 3. Mai 2026 (englisch). Case and Space Sensitivity. MathWorks, archiviert vom Original (nicht mehr online verfügbar) am...
Click to read more »Geräuschpegelabstand
Jumat, 2020-04-24 01:59:273-910098-19-3 Systeme der Audiosignalverarbeitung (PDF; 4,48 MB) Mikrofonpegel und ihre Bezugswerte (PDF; 200 kB) Mikrofon-Empfindlichkeit (sensitivity)...
Click to read more »Dingo
Selasa, 2026-05-05 16:35:192001, S. 76, doi:10.1046/j.1365-2664.2001.00569.x. J. C. McIlroy: The Sensitivity of Australian Animals to 1080 Poison 11. Marsupial and Eutherian Carnivores...
Click to read more »Dan Cacuci
Minggu, 2026-05-10 05:05:30an der Columbia University). doi:10.2172/12131479 Sensitivity and Uncertainty Analysis Sensitivity and Uncertainty Analysis. Volume 1: Theory. Chapman...
Click to read more »Vogelzug
Senin, 2026-07-13 03:06:16Church, Julian C. Partridge: Behavioural investigation of polarisation sensitivity in the Japanese quail (Coturnix coturnix japonica) and the European starling...
Click to read more »Getränkedose
Senin, 2026-08-10 11:36:2084 % der Limonaden und Cola in Dosen mit Bisphenol A belastet. Chemical Sensitivity Network, 6. März 2009, abgerufen am 17. September 2013. Carsten Dierig:...
Click to read more »The Shapeshifters
Senin, 2026-04-20 20:34:56Incredible (Nocturnal Groove) 2006: If In Doubt Go Out (Positiva) 2006: Sensitivity feat. Chic (Positiva) 2007: Pusher (Positiva) 2007: New Day (Positiva)...
Click to read more »Gruppendynamik
Senin, 2026-01-26 20:21:57des gruppendynamischen Trainings ist die T-Gruppe (im engl. auch als sensitivity training group bezeichnet). In der T-Gruppe arbeiten 7–15 Teilnehmer...
Click to read more »Kokosöl
Jumat, 2026-02-20 01:28:14consumption improves fat-free mass, plasma HDL-cholesterol and insulin sensitivity in healthy men with normal BMI compared to peanut oil. In: Clinical Nutrition...
Click to read more »Still Alice – Mein Leben ohne Gestern
Jumat, 2026-05-15 23:35:34is a heartfelt drama that honors its delicate themes with bravery and sensitivity.) Bei Metacritic erhält der Film eine Bewertung von 72/100, basierend...
Click to read more »Kohlenstoffdioxid in der Erdatmosphäre
Rabu, 2026-07-08 06:47:141073/pnas.0812721106 (englisch). Richard E. Zeebe: Time-dependent climate sensitivity and the legacy of anthropogenic greenhouse gas emissions. In: pnas. 110...
Click to read more »Wissen
Minggu, 2026-08-02 20:32:45Interest. Oxford University Press 2005. John MacFarlane: The Assessment Sensitivity of Knowledge Attributions. Oxford Studies in Epistemology 1 (2005), S...
Click to read more »Speisesalz
Kamis, 2026-06-25 16:27:41(wiley.com [abgerufen am 18. Mai 2025]). V. Franco, S. Oparil: Salt sensitivity, a determinant of blood pressure, cardiovascular disease and survival...
Click to read more »Myalgische Enzephalomyelitis/Chronisches Fatigue-Syndrom
Senin, 2026-08-10 04:14:10Nelson, Jonathan D. Buckley, Rebecca L. Thomson et al.: Diagnostic sensitivity of 2-day cardiopulmonary exercise testing in Myalgic Encephalomyelitis/Chronic...
Click to read more »Pentosanpolysulfat-Natrium
Kamis, 2026-04-23 13:58:40Albrecht: Effect of pentosan polysulfate therapy on intravesical potassium sensitivity. In: Urology. 59. Jahrgang, Nr. 3, 2002, S. 329–333, doi:10.1016/s0090-4295(01)01586-2...
Click to read more »Meares Irlen Syndrom
Minggu, 2026-05-17 21:37:34Meares-Irlen-Syndrom, auch Irlen-Syndrom, Visual Stress oder Scotopic Sensitivity Syndrome (skotopisches Sensitivitätssyndrom), werden visuelle Missempfindungen...
Click to read more »Flughafen
Minggu, 2026-03-01 01:41:58unterschiedlich bewertet wird. Das Umweltbundesamt definiert einen Noise Sensitivity Depreciation Index (NSDI) mit 0,87 % je dB(A) als Ergebnis einer Auswertung...
Click to read more »Liste der Abkürzungen zur globalen Erwärmung
Kamis, 2026-07-02 02:44:47ECS Equilibrium Climate Sensitivity Gleichgewichtsklimasensitivität EHS Emissionshandelssystem EITE emisson-intensive und trade exposed emissionsintensive...
Click to read more »Jordan Peterson
Sabtu, 2026-06-27 17:34:35(researchgate.net). Stewart S. H., Peterson J. B., Pihl R. O.: Anxiety sensitivity and self-reported alcohol consumption rates in university women. In:...
Click to read more »Nilflughund
Sabtu, 2026-07-04 02:01:11Abgerufen am 9. Januar 2018. D. R. Griffin, A. Novick, M. Kornfield: The sensitivity of echolocation in the fruit bat, rousettus. In: The Biological Bulletin...
Click to read more »Herpes-simplex-Enzephalitis
Sabtu, 2025-11-29 17:41:54(2001) 248(6), S. 469–477. (Review) PMID 11499636 F. Focher u. a.: Sensitivity of monkey B virus (Cercopithecine herpesvirus 1) to antiviral drugs:...
Click to read more »Polychlorierte Dibenzodioxine und Dibenzofurane
Selasa, 2026-05-12 03:13:12D. Jones, Y. Wan, B. Collins, J. L. Newsted, D. Kay, S. J. Bursian: Sensitivity of Japanese quail (Coturnix japonica), Common pheasant (Phasianus colchicus)...
Click to read more »Cuticula (Pflanzen)
Jumat, 2026-05-08 03:27:55E. Kolattukudy: Biosynthetic pathways of cutin and waxes, and their sensitivity to environmental stresses. In: G. Kerstiens (Hrsg.): Plant Cuticles....
Click to read more »Nährmedium
Selasa, 2026-06-02 03:59:33Ralf Reski (1995) Gelrite and agar differently influence cytokinin-sensitivity of a moss. Journal of Plant Physiology 146, 369–371. Eckhard Bast: Mikrobiologische...
Click to read more »Numerische Wettervorhersage
Jumat, 2026-06-19 21:43:03und COSMO-ART, auf dwd.de Modeling of gas and aerosol with WRF/Chem over Europe: Evaluation and sensitivity study, auf agupubs.onlinelibrary.wiley.com...
Click to read more »Opioide
Rabu, 2026-04-22 01:28:23ISBN 3-13-140543-0. Martin S. Angst, Nicholas G. Phillips et al.: Pain sensitivity and opioid analgesia: a pharmacogenomic twin study. In: Pain. 2012. doi:10...
Click to read more »Rückwärtige Belichtung
Jumat, 2026-04-17 19:17:08back-illuminated CMOS image sensor, realizing high picture quality, nearly twofold sensitivity(*1) and low noise. In: sony.com. 11. Juni 2008, abgerufen am 19. Februar...
Click to read more »Michael Hantel
Rabu, 2026-08-05 19:17:42Band 67, 1998, S. 135–152. mit M. Ehrendorfer, A. Haslinger: Climate Sensitivity of Snow Cover Duration in Austria, International Journal of Climatology...
Click to read more »Marcus Conrad
Minggu, 2026-06-28 05:14:24José Pedro Friedmann Angeli, Marcus Conrad: ACSL4 dictates ferroptosis sensitivity by shaping cellular lipid composition. In: Nature Chemical Biology. Band 13...
Click to read more »Emma Kirkby
Kamis, 2026-08-06 00:03:23with minimal vibrato, her natural declamation, agile coloratura and her sensitivity to words have been widely admired by interpreters of early, Renaissance...
Click to read more »A-nicht-B-Suchfehler
Minggu, 2025-01-12 19:05:17Topal, G. Gergely, A. Erdohegyi, G. Csibra, A. Miklosi: Differential Sensitivity to Human Communication in Dogs, Wolves, and Human Infants. In: Science...
Click to read more »Konjugierte Linolsäuren
Selasa, 2026-01-06 07:46:513165), increase in lean body mass (ID 498, 731), increase in insulin sensitivity (ID 1517), protection of DNA, proteins and lipids from oxidative damage...
Click to read more »Elektrosmog
Jumat, 2026-06-26 21:44:35Phone Base Station Signals Increase Symptoms in Individuals Who Report Sensitivity to Electromagnetic Fields? A Double-Blind Randomized Provocation Study...
Click to read more »Kernspinresonanzspektroskopie
Kamis, 2026-03-26 19:10:37abundance double quantum transfer spectroscopy) 13C-ADEQUAT (adequate sensitivity double quantum transfer spectroscopy) 1D/2D-DOSY (diffusion ordered spectroscopy)...
Click to read more »Neurodiversität
Selasa, 2026-06-30 21:36:54Abgerufen am 22. Januar 2025 (englisch). Belek: Articulating Sensory Sensitivity: From Bodies with Autism to Autistic Bodies. In: Medical Anthropology...
Click to read more »Glomeruläre Filtrationsrate
Jumat, 2026-06-05 21:50:53G. Filler, F. Priem, I. Vollmer, J. Gellermann, K. Jung: Diagnostic sensitivity of serum cystatin for impaired glomerular filtration rate. In: Pediatric...
Click to read more »Oligozän
Sabtu, 2026-06-27 20:57:36James Hansen, Makiko Sato, Gary Russell, Pushker Kharecha: Climate sensitivity, sea level and atmospheric carbon dioxide. In: Philosophical Transactions...
Click to read more »Chloroquin
Kamis, 2026-06-18 13:41:34Markus Winterberg, Nicholas PJ Day, Joel Tarning, Daniel Blessborn: High sensitivity methods to quantify chloroquine and its metabolite in human blood samples...
Click to read more »Low-Carb
Selasa, 2026-04-14 16:55:29abgerufen am 4. März 2011]). Mark E Daly: Acute effects on insulin sensitivity and diurnal metabolic profiles of a high-sucrose compared with a high...
Click to read more »Lukas Klaschinski
Jumat, 2026-02-27 14:09:11Schröder-Abé: Benefits of power posing: effects on dominance and social sensitivity. In: Comprehensive Results in Social Psychology. Band 2, Nr. 1, 2. Januar...
Click to read more »PICO
Kamis, 2026-05-07 14:30:49Outcome = Lebensqualität McMaster University (PICO) Agoritsas T et al.: Sensitivity and predictive value of 15 PubMed search strategies to answer clinical...
Click to read more »Stickstoffhypoxie
Minggu, 2026-04-26 02:21:56NOX4-dependent neuronal autotoxicity and BBB breakdown explain the superior sensitivity of the brain to ischemic damage. In: Proceedings of the National Academy...
Click to read more »Galactose-α-1,3-galactose
Minggu, 2026-01-25 08:49:41Correlation between clinical findings and laboratory tests for alpha gal sensitivity. In: Annals of Allergy, Asthma & Immunology. Band 119, Nr. 5, November...
Click to read more »Methan
Senin, 2026-08-10 00:24:40Bruce Buffett, David Archer: Global inventory of methane clathrate: sensitivity to changes in the deep ocean. In: Earth and Planetary Science Letters...
Click to read more »Digitalkamera
Rabu, 2026-05-27 15:39:45Kontrastempfindungsfunktion (Contrast Sensitivity Function, CSF) über der Ortsfrequenz in Linienpaaren pro Bildhöhe...
Click to read more »Beurteilung eines binären Klassifikators
Sabtu, 2025-11-22 02:09:25(auch Richtig-positiv-Rate, Empfindlichkeit oder Trefferquote; englisch sensitivity, true positive rate, recall oder hit rate) gibt die Wahrscheinlichkeit...
Click to read more »Tetrahydrocannabivarin
Minggu, 2026-01-25 00:13:37The cannabinoid Δ(9)-tetrahydrocannabivarin (THCV) ameliorates insulin sensitivity in two mouse models of obesity. In: Nutrition & diabetes. Band 3, 2013...
Click to read more »Stillen
Selasa, 2026-08-04 23:17:31John R. Britton, Helen L. Britton, Virginia Gronwaldt: Breastfeeding, Sensitivity, and Attachment. Pediatrics, Band 118, Heft 5, November 2006 (Abstract)...
Click to read more »Mentalisierung
Sabtu, 2026-08-08 01:22:37E. Mains, C. Fernyhough, E. Fradley, M. Tuckey: Rethinking maternal sensitivity: Mothers’ comments on infants mental processes predict security of attachment...
Click to read more »COVID-19-Pandemie
Rabu, 2026-08-12 09:25:17Imperial College London, Report 4. Neil M. Ferguson et al.: Relative sensitivity of international surveillance (PDF) (Memento vom 5. März 2020 im Internet...
Click to read more »Gamersprache
Rabu, 2026-07-22 22:20:30Highsenser stellen die Geschwindigkeit bzw. die Genauigkeit (von engl. sensitivity) der Maus hoch ein und können daher in Ego-Shootern sehr schnell reagieren...
Click to read more »Backpropagation
Kamis, 2026-03-12 02:07:49University 1974. Paul Werbos: Applications of advances in nonlinear sensitivity analysis. In: System modeling and optimization. Springer, Berlin/Heidelberg...
Click to read more »Morbus Behçet
Selasa, 2026-06-02 17:01:49Behçet’s Disease (ICBD): a collaborative study of 27 countries on the sensitivity and specificity of the new criteria. In: Journal of the European Academy...
Click to read more »Thomas M. Klapötke
Kamis, 2025-12-25 19:58:07Keshavarz, Thomas M. Klapötke, The Properties of Energetic Materials - Sensitivity, Physical and Thermodynamic Properties, 2. Auflage, de Gruyter, Berlin...
Click to read more »Globale Erwärmung
Senin, 2026-08-10 00:16:39Jonathan LaRiviere, Ana Christina Ravelo: High Earth-system climate sensitivity determined from Pliocene carbon dioxide concentrations. In: Nature Geoscience...
Click to read more »Höchstspannungsleitung
Jumat, 2026-05-08 07:32:25Jeffery: The spectral transmission of ocular media suggests ultraviolet sensitivity is widespread among mammals. In: Proc. R. Soc. B., 2014, S. 281(1780);...
Click to read more »Niederschlagsradar
Sabtu, 2026-06-06 01:40:54Zeit nach dem Impuls. Diese zeitabhängige Verstärkungsregelung wird sensitivity time control genannt. Stärke des Echosignals: Diese hängt sowohl von...
Click to read more »Permafrost
Rabu, 2026-06-10 10:54:23Frederick, Jorien E Vonk: Subsea permafrost carbon stocks and climate change sensitivity estimated by expert assessment. In: Environmental Research Letters. Band 15...
Click to read more »Kohlenstoffkreislauf
Kamis, 2026-07-16 21:30:46Eleanor J. Burke, Charles D. Koven: A spatial emergent constraint on the sensitivity of soil carbon turnover to global warming. In: Nature Communications...
Click to read more »Hebephilie
Rabu, 2026-04-08 21:42:12Hebephilie in das DSM-5 von Karen Franklin James M. Cantor, Ian V. McPhail: Sensitivity and Specificity of the Phallometric Test for Hebephilia. In: The Journal...
Click to read more »Encounter (Psychologie)
Senin, 2026-05-04 05:45:19den wichtigsten Therapieformen zählen Basic Encounter von Carl Rogers, Sensitivity Training in der Gruppendynamik, Open Encounter von Will Schutz, Casriel-Therapie...
Click to read more »Eva Luna (Roman)
Minggu, 2026-07-12 16:27:37recruits“ – Cox, Eva Luna, S. 78. „macho code“ – Cox, Eva Luna, S. 84. „sensitivity despite his hard exterior“ – Cox, Eva Luna, S. 86. „sexist guerrilla“...
Click to read more »Hintertuxer Gletscher
Kamis, 2026-07-23 20:23:06Olivier Gagliardini, Delphine Six, Guillaume Gastineau, Christian Vincent: Sensitivity of Glaciers in the European Alps to Anthropogenic Atmospheric Forcings:...
Click to read more »Piperin
Selasa, 2026-03-03 19:17:45the Derivatives in Long Pepper Extract by HPLC Using Relative Molar Sensitivity. In: Food Hygiene and Safety Science (Shokuhin Eiseigaku Zasshi). Band 60...
Click to read more »PSL
Jumat, 2026-06-05 15:10:47Soccer League, höchste Spielklasse im südafrikanischen Fußball Process Sensitivity Level, Maß der Elektronik zur Empfindlichkeit eines Bauteils Process...
Click to read more »Creatin-Kinase
Minggu, 2026-03-01 22:22:16Phosphocreatine Circuit: Molecular and Cellular Physiology of Creatine Kinases, Sensitivity to Free Radicals, and Enhancement by Creatine Supplementation. In: Valdur...
Click to read more »Galoppierender Treibhauseffekt
Senin, 2026-05-11 02:25:311810141115 James Hansen, Makiko Sato, Gary Russell, Pushker Kharecha: Climate sensitivity, sea level and atmospheric carbon dioxide. In: Philosophical Transansactions...
Click to read more »Geographie Australiens
Rabu, 2025-03-19 20:26:33höchster Punkt: Big Ben, Heard-Insel: 2745 m Miller, Gifford et al. Sensitivity of the Australian Monsoon to insolation and vegetation: Implications...
Click to read more »Biodiesel
Kamis, 2026-08-06 07:16:00Michael R. Olson, Tomoaki Okuda, Kenneth A. Walz, James J. Schauer: Sensitivity of hazardous air pollutant emissions to the combustion of blends of petroleum...
Click to read more »Emetophobie
Sabtu, 2026-01-31 19:38:47K. Bouman: An internet-based study on the relation between disgust sensitivity and emetophobia. In: Journal of Anxiety Disorders. 2008, 22(3), S. 524–531...
Click to read more »Fettsäure-Elongasen
Jumat, 2026-03-06 21:11:07Shimano H: Elovl6: a new player in fatty acid metabolism and insulin sensitivity. In: J Mol Med. 87. Jahrgang, Nr. 4, April 2009, S. 379–84, doi:10...
Click to read more »ATP-Synthase
Rabu, 2026-08-12 19:31:24ATP5E F1ε 51 606153 20q13.3 ATP5O F1O 213 600828 21q22.1-22.2 Oligomycin sensitivity conferral protein ATP5F1 Fob 256 603270 1p13.2 ATP5G1 Foc Isoform 1 136...
Click to read more »Epworth Sleepiness Scale
Senin, 2024-04-15 20:59:55(Offizielle Website), abgerufen am 21. Januar 2013. Murray W. Johns: Sensitivity and specificity of the multiple sleep latency test (MSLT), the maintenance...
Click to read more »Forschungsgeschichte des Klimawandels
Minggu, 2026-06-14 17:45:30Climate Model with Seasonal Variation for Future Studies of Climate Sensitivity. In: Dynamics of Atmospheres and Oceans 3, 1979, S. 393–426 J. D. Hays...
Click to read more »Lärm
Selasa, 2026-05-19 07:46:36J Hautus, Kauko Heikkilä: Elucidating the relationship between noise sensitivity and personality. In: Noise & Health. Band 17, Nr. 76, 2015, S. 165–171...
Click to read more »Wirkungsgrad
Senin, 2026-06-08 17:25:08Audiodateien Kennschalldruckpegel und Wirkungsgrad bei passiven Lautsprechern (sensitivity) Wirkungsgrad von Bühnenscheinwerfern Energetischer Wirkungsgrad – Erklärung...
Click to read more »Psychologische Unterschiede zwischen Männern und Frauen
Sabtu, 2026-07-25 19:41:50researchgate.net). Di You, Yukiko Maeda: Gender Differences in Moral Sensitivity: A Meta-Analysis. In: Ethics & Behavior. 21. Jahrgang, Nr. 4, 2011, S...
Click to read more »Kleinschreibung
Rabu, 2026-05-13 03:16:55Staaten von Amerika“ und Svenska kyrkan „die schwedische Kirche“. Case sensitivity Binnenmajuskel Wiktionary: Kleinschreibung – Bedeutungserklärungen, Wortherkunft...
Click to read more »Klimageschichte
Rabu, 2026-03-18 15:21:581073/pnas.0812721106 (englisch). Richard E. Zeebe: Time-dependent climate sensitivity and the legacy of anthropogenic greenhouse gas emissions. In: PNAS. Band 110...
Click to read more »Palmitoleinsäure
Rabu, 2026-07-01 13:08:53Luis Martinez: Purified palmitoleic acid for the reduction of high-sensitivity C-reactive protein and serum lipids: A double-blinded, randomized, placebo...
Click to read more »Diedrich Diederichsen (Kulturwissenschaftler)
Selasa, 2026-07-07 18:42:08978-3-943365-76-4 (deutsch) Love and Ethnology. The Colonial Dialectic of Sensitivity (after Hubert Fichte) / Liebe und Ethnologie. Die koloniale Dialektik...
Click to read more »Bernd Lößner
Sabtu, 2026-03-21 22:59:36(AgRuD)-Patientenberatungsstelle der Deutschen Gesellschaft Multiple-Chemical-Sensitivity (DGMCS) e.V. tätig. Bernd Lößner verstarb am 6. Februar 2014 im Alter...
Click to read more »Parkinson Neuropsychometric Dementia Assessment
Sabtu, 2026-07-11 19:50:42Tools with Age Correction and Weighting of Subtests According to Their Sensitivity and Specificity. In: Journal of Alzheimer’s Disease. 34, 2013, S. 813–834...
Click to read more »Kernphotoeffekt
Selasa, 2025-11-25 06:00:043834818151 W. Rapp, J. Görres, M. Wiescher, H. Schatz, F. Käppeler: Sensitivity of p-Process Nucleosynthesis to Nuclear Reaction Rates in a 25 M☉ Supernova...
Click to read more »Mikrobarome
Kamis, 2024-08-22 21:01:33Oktober 2023, abgerufen am 10. Oktober 2023. Albatross movement suggests sensitivity to infrasound cues at sea pnas.org, 9. Oktober 2023, abgerufen am 10...
Click to read more »Politische Korrektheit
Jumat, 2026-07-31 18:43:20the homosexuality of a famous athlete, he was required to attend gay-sensitivity sessions and publish a piece of self-criticism in the student newspaper...
Click to read more »Feldhamster
Jumat, 2026-07-17 20:09:51Wollnik: Seasonal variations in circadian rhythms coincide with a phase of sensitivity to short photoperiods in the European hamster. In: Journal of Comparative...
Click to read more »Oraler Glukosetoleranztest
Rabu, 2026-04-22 00:53:53abgerufen am 20. Februar 2011 (englisch). M Matsuda, RA DeFronzo: Insulin sensitivity indices obtained from oral glucose tolerance testing: comparison with...
Click to read more »Braunes Fettgewebe
Sabtu, 2026-06-06 15:38:51mirabegron treatment increases human brown fat, HDL cholesterol, and insulin sensitivity. In: Journal of Clinical Investigation. Band 130, Nr. 5, 23. März 2020...
Click to read more »Goldmulle
Sabtu, 2025-12-13 07:21:17276, 2015, S. 900–914 Matthew J. Mason und Peter M. Narins: Seismic sensitivity in the Desert golden mole (Eremitalpa granti): A review. Journal of Comparative...
Click to read more »Großschreibung
Jumat, 2026-04-03 14:41:37bestimmte) Kirche gelten keine einheitlichen Regeln. Binnenmajuskel Case sensitivity Brigitte Labs-Ehlert: Versalschreibung in althochdeutschen Sprachdenkmälern...
Click to read more »Phagentherapie
Selasa, 2026-08-11 15:51:15Kaitlyn E. Kortright, Deepak Narayan: Phage selection restores antibiotic sensitivity in MDR Pseudomonas aeruginosa. In: Scientific Reports. Band 6, 26. Mai...
Click to read more »Jeffrey Alan Gray
Sabtu, 2024-06-08 14:28:47Modifikation des Temperamentsmodells von Eysenck bekannt (Reinforcement Sensitivity Theorie). In diesem Zusammenhang arbeitete er an dem Verhaltensaktivierungssystem...
Click to read more »Meeresspiegelanstieg seit 1850
Jumat, 2026-06-19 16:17:29Gregory J. Hakim, Christopher J. Poulsen: Glacial cooling and climate sensitivity revisited. In: Nature. 584. Jahrgang, Nr. 7822, August 2020, S. 569–573...
Click to read more »Geschmacksstörung
Sabtu, 2026-02-07 04:13:26PMID 18628146. R. Matsuo: Role of saliva in the maintenance of taste sensitivity. In: Critical Reviews in Oral Biology and Medicine. Band 11, Nummer 2...
Click to read more »Slump-Test (Neurologie)
Rabu, 2026-03-18 14:19:46September 2014, C. Lange J. Majlesi, H. Togay, H. Unalan, S. Toprak: The sensitivity and specificity of the Slump and the Straight Leg Raising tests in patients...
Click to read more »Digital Polymerase Chain Reaction
Senin, 2018-11-12 03:16:36Grant, E. Nastouli, C. A. Foy, J. F. Huggett: Comparative study of sensitivity, linearity, and resistance to inhibition of digital and nondigital polymerase...
Click to read more »Attachment Parenting
Jumat, 2026-07-17 18:06:19haben sie dafür den Begriff der mütterlichen Feinfühligkeit (maternal sensitivity) übernommen: Die Frau richtet ihre Aufmerksamkeit ganz aufs Kind („Babyreading“)...
Click to read more »Ligyrophobie
Selasa, 2026-06-02 18:17:54Goodworth: Sound Tolerance Conditions (Hyperacusis, Misophonia, Noise Sensitivity, and Phonophobia): Definitions and Clinical Management. In: American...
Click to read more »Verhalten (Biologie)
Selasa, 2025-06-24 15:48:53Efrat Dener, Alex Kacelnik und Hagai Shemesh: Pea Plants Show Risk Sensitivity. In: Current Biology. Band 26, Nr. 13, 2016, S. 1763–1767, doi:10.1016/j...
Click to read more »Friedrich Luft (Mediziner)
Jumat, 2025-08-01 03:41:27E. Grim, N. S. Fineberg: Definitions and characteristics of sodium sensitivity and blood pressure resistance. In: Hypertension, Band 8, Supl. II, 1986...
Click to read more »Gödel-Preis
Jumat, 2026-06-05 22:26:19Nissim und Adam Davison Smith für ihren Aufsatz Calibrating Noise to Sensitivity in Private Data Analysis zu Differential Privacy 2018 Oded Regev für...
Click to read more »Reaktorsicherheit
Senin, 2026-07-06 02:17:38Anne-Sophie Hacquin, Sacha Altay, Lene Aarøe, Hugo Mercier: Disgust sensitivity and public opinion on nuclear energy. In: Journal of Environmental Psychology...
Click to read more »Fusarium
Kamis, 2026-08-06 19:08:02new meat substitute, UPI, April 7, 2020 S. J. Katona, E. R. Kaminski: Sensitivity to Quorn mycoprotein (Fusarium venenatum) in a mould allergic patient...
Click to read more »Jan-Heiner Tück
Jumat, 2026-07-17 01:57:50theology, philosophy, and literature, and with a commendable ecumenical sensitivity, Tück achieves in this insightful work a remarkable fusion of theology...
Click to read more »Solarisation (Fotografie)
Selasa, 2026-07-28 23:16:15Fotokinoverlag, Leipzig 1974, S. 74–75. Tadaaki Tani: Photographic Sensitivity: Theory and Mechanisms. Oxford University Press, New York 1995, ISBN...
Click to read more »Orthokeratologie
Jumat, 2025-08-08 19:14:26on visual acuity, refractive error, corneal topography and contrast sensitivity. In: Eye & contact lens. 34, 4, 2008, S. 224–248. Kojima, Hasegawa, Hara...
Click to read more »Ammoniumheptamolybdat
Sabtu, 2026-01-24 15:23:52J. Borge, J. Dubochet: Cryo-negative staining reduces electron-beam sensitivity of vitrified biological particles, in: Journal of Structural Biology...
Click to read more »Shure SM57
Minggu, 2025-07-27 04:54:34Tonaderspeisung. Die Anschlussimpedanz beträgt etwa 310 Ohm. Die Empfindlichkeit (Sensitivity) liegt bei 1 kHz bei −56,0 dBV/Pa (1,60 mV/Pa); der zulässige maximale...
Click to read more »Magnetsinn
Rabu, 2026-07-22 16:44:28orientation and navigation of juvenile alligators: evidence of magnetic sensitivity. In: Journal of Comparative Physiology A. Band 154, Nr. 5, 1984, S. 649–658...
Click to read more »Ekel
Jumat, 2026-07-24 15:40:32Crowell, David Tang, Eddie Harmon-Jones, Brandon J. Schmeichel: Disgust sensitivity predicts defensive responding to mortality salience. In: Emotion. Band 15...
Click to read more »Rating of perceived exertion
Rabu, 2024-12-11 21:12:24J. McMurray, H. Dargie: A Comparison of the Reproducibility and the Sensitivity to Change of Visual Analogue Scales, Borg Scales, and Likert Scales in...
Click to read more »Gertrude Rand
Jumat, 2025-08-08 19:44:28promovierte. Ihre Dissertation trug den Titel: The factors that influence the sensitivity of the retina to color: A quantitative study and methods of standardizing...
Click to read more »Befindlichkeitsstörung
Sabtu, 2025-06-14 18:11:34Epidemische Neuromyasthenie, Fibromyalgie (Fibrositis), Multiple Chemical Sensitivity, Chronisches Fatigue-Syndrom. Die Einordnung des Chronischen Fatigue-Syndroms...
Click to read more »Verhaltenshemmung
Sabtu, 2018-09-29 00:08:17Jeffrey Alan Gray (1982, 1987, 1990) unterscheidet nach der Reinforcement Sensitivity Theorie drei biologische Systeme, die das Verhalten steuern sollen: das...
Click to read more »Wolfgang Schamel
Selasa, 2025-11-25 21:31:32P. Dopfer, D. L. Wiest, L. A. Turka, W. W. Schamel, E. Palmer: High-sensitivity detection and quantitative analysis of native protein-protein interactions...
Click to read more »Laser Interferometer Space Antenna
Jumat, 2026-07-03 15:09:31Yamamoto, C. C. Yancey, H. Yu, L. Zhang, M. E. Zucker, J. Zweizig: Sensitivity of the Advanced LIGO detectors at the beginning of gravitational wave...
Click to read more »EQ. Emotionale Intelligenz
Selasa, 2026-01-20 12:27:18104 Emotional Intelligence (1995), S. 104; Robert Rosenthal et al.: Sensitivity to Nonverbal Communication: The PONS Test, The Johns Hopkins University...
Click to read more »Ortsfrequenz
Sabtu, 2025-12-27 17:31:40Objekts wird als Kontrastempfindlichkeitsfunktion (englisch Contrast Sensitivity Function (CSF)) angegeben. Sie ist das Produkt aus der rein optischen...
Click to read more »SISI-Test
Senin, 2018-11-05 13:25:39Der SISI-Test (Short Increment Sensitivity Index) ist eine audiometrische Methode der Hals-Nasen-Ohrenheilkunde, mit der die Erkennbarkeit kleiner...
Click to read more »Lutz Eckstein
Selasa, 2026-04-21 15:09:53Transportmittel 2012. Braunschweig 2012. mit M. Wimmershof, C. Klas, A. Zlocki: Sensitivity analysis for model based fusion of camera systems with navigation data...
Click to read more »Grüner Blattwurm
Kamis, 2020-05-14 16:06:11Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...
Click to read more »Solar-C
Selasa, 2026-06-16 06:45:20Der High-sensitivity Solar Ultraviolet Spectroscopic Satellite, kurz Solar-C, ist ein geplantes Weltraumteleskop zur Sonnenbeobachtung, das von der japanischen...
Click to read more »Transparency International
Kamis, 2026-05-14 23:10:58Fehleinschätzung (political bias) und die Fehleinschätzung durch Sensitivität (sensitivity bias) bzw. die soziale Erwünschtheit als Hauptursachen fehlerhafter Ergebnisse...
Click to read more »Bunter Kalkröhrenwurm
Kamis, 2024-03-21 23:28:51Hawkins, R. Seed: Biogenic Reefs (volume IX). An overview of dynamic and sensitivity characteristics for conservation management of marine SACs. Scottish...
Click to read more »Abkürzungen/Luftfahrt/S–Z
Selasa, 2026-03-10 15:33:13Straight-in Direktanflug (zur Landung) S Standby Reserve, Bereitschaft S Sensitivity Level (S) Summer Time Sommerzeit SA Selective Availability künstlich...
Click to read more »Altern
Sabtu, 2026-08-08 00:20:48Patterson: Dietary Fat and Carbohydrates Differentially Alter Insulin Sensitivity During Caloric Restriction. In: Gastroenterology. Band 136, Nr. 5, 1...
Click to read more »Liste von Psychotherapie- und Selbsterfahrungsmethoden
Minggu, 2026-02-15 19:15:00oder Organisationslaboratorium Selbsterfahrungsgruppe Encounter-Gruppe Sensitivity-Gruppe TZI-Gruppe Therapeutische Gemeinschaft nach S. H. Foulkes, Wilfred...
Click to read more »Schwingquarz
Jumat, 2026-04-17 20:24:48US4419600: Stress-compensated quartz resonators. Patent US5686779: High sensitivity temperature sensor and sensor array. Y Cut Crystal (Memento vom 30....
Click to read more »Bioassay
Selasa, 2025-10-14 09:11:53wissenschaft-online.de/abo/lexikon/biok/1508. K.M. Dorries et al. (1997). Sensitivity and behavioral responses to the pheromone androstenone are not mediated...
Click to read more »Pyrolant
Senin, 2024-03-04 22:26:29Seminar. 1992, S. 539. T. Kuwahara, T. Kohno, C. H. Wang: Static Electric Sensitivity Characteristics of Zr/BaCrO4, Pyrolants. In: Prop., Explos., Pyrotech...
Click to read more »KATRIN
Senin, 2026-05-04 19:29:37pdf, 10,9 MB Direct neutrino-mass measurement with sub-electronvolt sensitivity, Nature, 14. Februar 2022 [1] First constraints on general neutrino interactions...
Click to read more »Kompaktleuchtstofflampe
Jumat, 2026-04-17 14:52:03Environmental impacts of lighting technologies — Life cycle assessment and sensitivity analysis. In: Environmental Impact Assessment Review. Band 31, 2011,...
Click to read more »Große Wachsmotte
Senin, 2026-04-27 12:33:48Landwirtschaftsverlag 1984 Hannah M. Moir et al.: Extremely high frequency sensitivity in a ‘simple’ ear. In: Biology Letters. Band 9, Nr. 4, 2013, doi:10.1098/rsbl...
Click to read more »Folgen der globalen Erwärmung
Kamis, 2026-07-30 02:47:09B. Buffet, D. Archer (2004): Global inventory of methane clathrate: sensitivity to changes in the deep ocean, in: Earth and Planetary Science Letters...
Click to read more »Strahlungshärten
Selasa, 2026-06-09 17:59:16verstärkten Effekten mit niedriger Dosisleistung (engl. enhanced low dose rate sensitivity, ELDRS), Neutronen- und Protonenverschiebungsschäden und Einzelereigniseffekten...
Click to read more »Robert Hummel
Rabu, 2025-11-26 09:08:37Hummel zu Gegen die Angst Podcast Stichwort Drehbuch mit Robert Hummel zu Sensitivity-Beratung https://www.filmstoffentwicklung.de/2016/gaeste/robert-hummel/...
Click to read more »Berthelot-Reaktion
Jumat, 2025-01-31 16:13:412023. (PDF; 8 kB). Tsuboi, T.; Hirano, Y.; Shibata, Y.; Motomizu, S.: Sensitivity Improvement of Ammonia Determination Based on Flow-Injection Indophenol...
Click to read more »Sebsi
Senin, 2021-02-08 05:47:14Improves Night Vision: A Case Study of Dark Adaptometry and Scotopic Sensitivity in Kif Smokers of the Rifmountains of Northern Morocco. In: Journal of...
Click to read more »Rana Adhikari
Selasa, 2025-06-03 02:39:06promoviert wurde mit einer Arbeit über Gravitationswellendetektoren (Sensitivity and noise analysis of 4 km laser interferometric gravitational wave antennae)...
Click to read more »Blutzuckerregulation
Kamis, 2026-06-11 19:46:23simple mathematical model supporting fast in-vivo estimation of insulin sensitivity and beta cell function. In: Scientific Reports. Band 12, Nr. 1, 21. Oktober...
Click to read more »G*Power
Senin, 2025-04-14 20:33:03erreichte Power, wenn α, Stichprobengröße und Effektgröße vorgegeben sind, "Sensitivity": Berechnet die Effektgröße, wenn α, Power und Stichprobengröße vorgegeben...
Click to read more »Macula densa
Jumat, 2024-12-13 15:36:04angiotensin II and nitric oxide on the afferent arteriole influence sensitivity of the tubuloglomerular feedback. In: Frontiers in Physiology. Band 4...
Click to read more »Rawson Marshall Thurber
Kamis, 2021-11-04 20:37:06Produzent (Executive Producer) 2004: Terry Tate, Office Linebacker: Sensitivity Training 2021: Red Notice Rawson Marshall Thurber bei IMDb Interview...
Click to read more »Feindesliebe
Rabu, 2026-01-14 17:56:11Jüdischer Verlag, 1982, ISBN 3-7610-0370-6, S. 614f. David Flusser: A new Sensitivity in Judaism and the Christian Message. Harvard Theological Review 61/1968...
Click to read more »Modulationsübertragungsfunktion
Minggu, 2025-12-21 23:17:35durch die Kontrastempfindlichkeitsfunktion beschrieben (CSF = Contrast Sensitivity Function). Das menschliche Auge ist bei rund 200 Linienpaare pro Bildbreite...
Click to read more »Hans Oberleithner
Rabu, 2025-03-19 12:17:13Kusche-Vihrog, Hans Oberleithner: An emerging concept of vascular salt sensitivity. In: F1000 Biology Reports. Band 4, 2. Oktober 2012, doi:10.3410/B4-20...
Click to read more »Freelite
Rabu, 2026-05-20 15:17:21for free kappa and free lambda immunoglobulin light chains: relative sensitivity for detection of monoclonal light chains. In: Clinical Chemistry. 48...
Click to read more »Chemical Injury Information Network
Sabtu, 2025-06-28 03:41:53von Cynthia Wilson. Robert S. Mayer: Strategies for Surviving Chemical Sensitivity. 2010, ISBN 978-0-578-05548-0 (englisch). Offizielle Website von Chemical...
Click to read more »Reto Knutti
Sabtu, 2025-12-27 20:33:18et al.: Global warming under old and new scenarios using IPCC climate sensitivity range estimates. In: Nature Climate Change. Band 2, 2012, S. 248–253...
Click to read more »Känozoisches Eiszeitalter
Sabtu, 2026-06-27 01:36:02Gregory J. Hakim, Christopher J. Poulsen: Glacial cooling and climate sensitivity revisited. In: Nature. Band 584, Nr. 7822, August 2020, S. 569–573, doi:10...
Click to read more »Lisa Barsotti
Jumat, 2026-01-23 23:57:21(Laudatio). The LIGO Scientific Collaboration: Exploring the sensitivity of next generation gravitational wave detectors, Classical and Quantum...
Click to read more »Rainer Schandry
Kamis, 2026-01-15 00:10:05Schandry, C. Leopold, W. P. Oettinger, H. Berg, R. Kulzer, J. Tritschler: Sensitivity of humans to low-frequency magnetic fields. In: Proc. EMC '96. 1996....
Click to read more »Moran Magal
Sabtu, 2026-06-06 06:28:10Bacharach in Israel teil. 2013 veröffentlichte sie ihr zweites Album Over Sensitivity. Dieses Album enthält ausschließlich Lieder auf Hebräisch. Im selben...
Click to read more »Freie Leichtketten
Kamis, 2026-03-05 14:14:29for free kappa and free lambda immunoglobulin light chains: relative sensitivity for detection of monoclonal light chains. In: Clinical Chemistry. 48...
Click to read more »FosB
Selasa, 2026-07-07 13:13:55Nestler: Expression of the transcription factor ΔFosB in the brain controls sensitivity to cocaine. In: Nature. Band 401, Nr. 6750, 1999, S. 272–276, doi:10...
Click to read more »Hangenberg-Ereignis
Sabtu, 2024-12-21 07:15:23Julia Brugger, Matthias Hofmann, Stefan Petri, Georg Feulner: On the Sensitivity of the Devonian Climate to Continental Configuration, Vegetation Cover...
Click to read more »Ralph Tresvant
Kamis, 2026-01-15 00:50:29hatte er hauptsächlich in den USA Erfolg. Sein größter Solohit hieß Sensitivity und stieg Ende 1990 bis auf Platz 4 der US-Charts und Anfang 1991 auf...
Click to read more »Mrs. Miniver
Minggu, 2026-03-15 03:08:38who have taken it gallantly. […] William Wyler has directed with a sensitivity that rarely shows in films. […] every one in the cast […] are excellent...
Click to read more »TPHA
Rabu, 2022-12-28 17:45:20S. 1016–1018, PMID 18080352. K. Manavi, H. Young, A. McMillan: The sensitivity of syphilis assays in detecting different stages of early syphilis. In:...
Click to read more »SDS-PAGE
Minggu, 2026-01-11 01:53:10with molecular masses 100,000–1000, and their detection with picomolar sensitivity. In: Electrophoresis. Band 12, Nummer 5, Mai 1991, S. 352–366, doi:10...
Click to read more »Korallenmoos
Senin, 2026-01-26 04:22:51officinalis (Coral Weed). In: Marine Life Information Network: Biology and Sensitivity Key Information Sub-programme (MarLIN). Abgerufen am 20. Mai 2008. Hayward...
Click to read more »Anti-Jo1-Antikörper
Minggu, 2025-07-27 22:50:40of antinuclear autoantibodies of defined specificities. I. Precision, sensitivity, and specificity. In: Arthritis & Rheumatism. Band 42, Nr. 3, 1999, S...
Click to read more »Archaeoglobus
Rabu, 2025-11-26 14:22:09Thermococcus kodakaraensis Affects CO2/O2 Substrate Specificity and Oxygen Sensitivity. In: PLOS ONE 18. September 2015; doi:10.1371/journal.pone.0138351,...
Click to read more »Methanhydrat
Selasa, 2026-06-23 15:57:30Petroleum & Coal, 56, 4, 2014, S. 407–417. Pezhman Kazemi, Roya Hamidi: Sensitivity Analysis of a Natural Gas Triethylene Glycol Dehydration Plant in Persian...
Click to read more »Gozintograph
Rabu, 2026-01-21 12:26:50set graphs. In: Tomas Gal, Harvey J. Greenberg (Hrsg.): Advances in sensitivity analysis and parametric programming. (= International Series in Operations...
Click to read more »Corona-Test
Sabtu, 2026-02-21 18:20:00[abgerufen am 28. Dezember 2020]). Chantal B.F. Vogels et al.: Analytical sensitivity and efficiency comparisons of SARS-COV-2 qRT-PCR primer-probe sets. medRxiv...
Click to read more »Helminthen-Therapie
Kamis, 2026-06-25 03:09:07the Human Hookworm Necator Americanus: Evaluating Immunity and Gluten-sensitivity - Full Text View - ClinicalTrials.gov. Abgerufen am 12. April 2022 (englisch)...
Click to read more »Isomere des Piperins
Jumat, 2026-03-13 14:29:02the Derivatives in Long Pepper Extract by HPLC Using Relative Molar Sensitivity. In: Food Hygiene and Safety Science (Shokuhin Eiseigaku Zasshi). Band 60...
Click to read more »Dreikantröhrenwurm
Sabtu, 2026-01-24 19:30:32Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...
Click to read more »Christina Hopfe
Jumat, 2023-12-08 22:30:15energy buildings, Routledge, ISBN 9781315726434, doi Uncertainty and sensitivity analysis in building performance simulation for decision support and...
Click to read more »De-novo-Synthese
Sabtu, 2025-01-11 04:34:56activation of AMPK and results in improved glucose handling and insulin sensitivity. In: Journal of diabetes and metabolic disorders. Band 13, 2014, S. 51...
Click to read more »Babatisee
Minggu, 2025-05-04 23:02:48Jerker Jarsjö: Water Balance and Level Change of Lake Babati, Tanzania: Sensitivity to Hydroclimatic Forcings. (PDF) 5. Dezember 2016, S. 3–4, abgerufen...
Click to read more »Ortho- und Parawasserstoff
Senin, 2025-01-20 03:09:54In: Z. Naturforsch. Nr. 34a, 1979, S. 163–166. Clifford R. Bowers: Sensitivity Enhancement Utilizing Parahydrogen. In: eMagRes. John Wiley & Sons, Ltd...
Click to read more »Henrik Svensmark
Kamis, 2026-07-02 14:29:31Zhang, 2021: The Earth’s Energy Budget, Climate Feedbacks, and Climate Sensitivity. In Climate Change 2021: The Physical Science Basis. Contribution of...
Click to read more »Clutter (Radar)
Senin, 2026-03-02 19:46:46sind deshalb sehr schwer zu unterdrücken. In der Praxis wird meist eine Sensitivity Time Control (STC) genutzt, um die meist im Nahbereich auftretenden Störungen...
Click to read more »Interkulturelle Kompetenz
Kamis, 2026-06-04 04:43:29Milton J. Bennett: A developmental approach to training for intercultural sensitivity. In: International Journal of Intercultural Relations. Nr. 10, 1986,...
Click to read more »Mario Szegedy
Selasa, 2026-01-06 06:07:35Solved in Two Pages, Quanta Magazine, 25. Juli 2019. Hao Huang, Induced subgraphs of hypercubes and a proof of the Sensitivity Conjecture, Arxiv 2019....
Click to read more »Anna von Rath
Senin, 2026-02-23 01:09:45abgerufen am 19. März 2025. 10 terms related to race that require sensitivity in translation. Abgerufen am 19. März 2025 (englisch). Übersetzer*innen...
Click to read more »Weizenhalmfaser
Kamis, 2026-04-16 12:06:07B. Otto, H. Viehoff et al.: Cereal Fiber Improves Whole-Body Insulin Sensitivity in Overweight and Obese Women. In: Diabetes Care. Band 29, Nr. 4, 2006...
Click to read more »Nordische Purpurschnecke
Jumat, 2026-04-17 17:55:56marlin.ac.uk. Marine Life Information Network: Biology and Sensitivity Key Information Sub-programme (on-line). Plymouth: Marine Biological...
Click to read more »Strandseeigel
Sabtu, 2021-11-06 18:39:41Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...
Click to read more »Cinchonismus
Kamis, 2026-02-19 01:36:17Heidelberg 1927 doi:10.1007/BF01863946 CD Calnan, GA Caron: Quinine Sensitivity. In: BMJ. 2. Jahrgang, Nr. 5269, 30. Dezember 1961, S. 1750–1752, doi:10...
Click to read more »Canine Demodikose
Kamis, 2025-07-24 08:25:4478 (2000), Heft 4, S. 240–242. M. N. Saridomichelakis u. a.: Relative sensitivity of hair pluckings and exudate microscopy for the diagnosis of canine...
Click to read more »Eiskeil
Senin, 2025-11-03 22:57:48B. T. Werner: Nonlinear dynamics of ice-wedge networks and resulting sensitivity. In: Nature. Band 417, 2002, S. 929–932. ( online (Memento vom 18. Oktober...
Click to read more »Hanns Hatt
Minggu, 2026-07-05 15:40:04Wellerdieck, M. Kuczkowiak, G. Gisselmann, H. Hatt: Specificity and sensitivity of a human olfactory receptor functionally expressed in human embryonic...
Click to read more »Toll-like-Rezeptoren
Selasa, 2025-11-11 21:32:56in cellular subsets of human peripheral blood mononuclear cells and sensitivity to CpG oligodeoxynucleotides. In: Journal of Immunology. Band 168, Nr...
Click to read more »24 Nights
Sabtu, 2026-07-04 01:02:14that I am a Gianni Versace fanatic... His approach to design and his sensitivity to colour appeal to the dormant artist in me and somehow I feel that...
Click to read more »Steven Reiss
Sabtu, 2024-11-23 06:53:43Steven Reiss, Rolf A Peterson, David M Gursky, Richard J McNally: Anxiety sensitivity, anxiety frequency and the prediction of fearfulness. In: Behaviour Research...
Click to read more »Trapped Ion Mobility Spectrometry
Minggu, 2026-01-11 18:24:54Accumulation–Serial Fragmentation (PASEF): Multiplying Sequencing Speed and Sensitivity by Synchronized Scans in a Trapped Ion Mobility Device. In: Journal of...
Click to read more »Landomycine
Sabtu, 2024-11-09 01:46:407164/antibiotics.43.492. O. V. Tymchyk, B. P. Matseliukh, V. I. Lavrinchuk: Sensitivity of Streptomyces globisporus 3-1–a highly active producer of landomycin...
Click to read more »Chic/Diskografie
Minggu, 2026-04-05 18:13:10Johnson feat. Chic Remixe von T Smoove, Gianni Bini und Paolo Martini 2006 Sensitivity Sound Advice — — — UK40 (3 Wo.)UK — — — Erstveröffentlichung: Juli 2006...
Click to read more »Langschnäuziges Seepferdchen
Selasa, 2025-11-25 01:36:54Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...
Click to read more »Isotopentrennung
Rabu, 2026-04-15 04:11:46Joseph A. Berry: Carbon isotopes and water use efficiency: sense and sensitivity. In: Oecologia. Band 155, Nr. 3, 2008, S. 441–454, doi:10.1007/s00442-007-0932-7...
Click to read more »Differential Privacy
Sabtu, 2025-04-05 23:18:02Dwork, Frank McSherry, Kobbi Nissim, Adam Smith: Calibrating Noise to Sensitivity in Private Data Analysis. In: Shai Halevi, Tal Rabin (Hrsg.): Theory...
Click to read more »Einstein-Teleskop
Senin, 2026-07-13 03:31:12www.et-gw.eu, 14 June 2022. Stefan Hild et al.: Pushing towards the ET sensitivity using ‘conventional’ technology. 24. November 2008, arxiv:0810.0604,...
Click to read more »Alexander Shapiro
Sabtu, 2025-08-09 17:23:21Programming, Reihe A. mit R. Y. Rubinstein: Discrete event systems: Sensitivity analysis and stochastic optimization by the score function method, Wiley...
Click to read more »Topo-optische Reaktion
Kamis, 2025-11-27 20:46:05doi:10.1016/j.acthis.2006.01.002, PMID 16542712. M. Bély, J. Makovitzky: Sensitivity and specificity of Congo red staining according to Romhányi. Comparison...
Click to read more »TKX-50
Minggu, 2026-01-25 17:17:001016/j.jhazmat.2017.05.040. Dilip Badgujar, Mahadev Talawar: Thermal and Sensitivity Study of Dihydroxyl Ammonium 5,5′-Bistetrazole-1,1′-diolate (TKX-50)-based...
Click to read more »Zirkoniumnitrid-Multilayerbeschichtung
Senin, 2020-12-21 00:26:4132(1), 2003 Jan, S. 60–64. N. Hallab, K. Merritt, J. J. Jacobs: Metal sensitivity in patients with orthopedic implants. In: J Bone Joint Surg Am. 83-A(3)...
Click to read more »Jens Claus Brüning
Sabtu, 2026-02-14 10:41:41Steculorum, Jens C. Brüning: Neuronal control of peripheral insulin sensitivity and glucose metabolism. In: Nature Communications. Band 8, Nr. 1, 4. Mai...
Click to read more »Gefingerte Klettenholothurie
Senin, 2019-07-29 20:34:06Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...
Click to read more »Milzbrandtoxin
Jumat, 2026-04-17 17:23:02S. I. Candille u. a.: Human genetic variation altering anthrax toxin sensitivity. In: Proceedings of the National Academy of Sciences. Band 109, Nummer...
Click to read more »Liste von Audio-Fachbegriffen
Selasa, 2026-08-11 14:05:26Gerät ausgelegt ist. Übertragungsfaktor – die Empfindlichkeit (engl.: Sensitivity), mit welcher der ↑ Schalldruck von Mikrofonen in elektrische Signalspannung...
Click to read more »Versfest berlin
Sabtu, 2026-04-18 03:49:21delight, because it deals with issues of growing up, like identity and the desire to fit in, with depth and sensitivity and in utterly beautiful verse.«...
Click to read more »Stefan Pieh
Jumat, 2025-08-15 20:15:59Grechenig, H. Weghaupt, C. Vass und C. Skorpik: Tritan colour contrast sensitivity function in refractive multifocal intraocular lenses. In: British Journal...
Click to read more »Erna Möller
Senin, 2024-12-16 15:54:06Akademie der Wissenschaften mit G. Möller: Quantitative studies of the sensitivity of normal and neoplastic mouse cells to the cytotoxic action of isoantibodies...
Click to read more »Paratyphus
Minggu, 2026-01-04 17:09:26Pitzer: The Relationship Between Blood Sample Volume and Diagnostic Sensitivity of Blood Culture for Typhoid and Paratyphoid Fever: A Systematic Review...
Click to read more »Baboon-Syndrom
Rabu, 2025-11-05 23:21:068917837. L. Fernandez, E. Maquiera u. a.: Baboon syndrome due to mercury sensitivity. In: Contact Dermatitis. Band 33, Nummer 1, Juli 1995, S. 56–57, PMID...
Click to read more »ADMX-Experiment
Sabtu, 2025-02-01 23:39:41Michael S. Turner, D. Moltz, J. Powell, N. Golubev: Results from a High-Sensitivity Search for Cosmic Axions. In: Physical Review Letters. Band 80, Nr. 10...
Click to read more »Kontroverse um die globale Erwärmung
Sabtu, 2026-06-27 16:51:56Using multiple observationally-based constraints to estimate climate sensitivity, Entwurf vom 30. Januar (PDF; 140 kB) (Memento vom 8. Juli 2011 im Internet...
Click to read more »Elektrische Impedanz-Tomografie
Selasa, 2025-08-19 21:49:001137–1154. C. W. Piccoli: Contrast-enhanced breast MRI: factors affecting sensitivity and specificity. In: Eur. Radiol. 7 Suppl 5, 1997, S. 281–288. P. H....
Click to read more »Jimmy Ruffin
Rabu, 2026-01-14 21:01:1617 eine EP ein und sang dabei die Stücke A Foolish Thing to Do und My Sensitivity. 1989 veröffentlichte er mit Brenda Holloway die das Duett On the Rebound...
Click to read more »Theoretische Sättigung
Minggu, 2022-11-20 22:05:03Hopf/Weingarten: Qualitative Sozialforschung (1979). Barney G. Glaser: Theoretical Sensitivity. Advances in the Methodology of Grounded Theory (1978). Anselm L. Strauss;...
Click to read more »Bernhard Ludvik
Rabu, 2024-12-04 01:55:55Influence of metabolic control on splanchnic glucose uptake, insulin sensitivity, and the time required for glucose absorption in patients with type 1...
Click to read more »James Martin (Theologe)
Minggu, 2026-03-15 23:57:09Community Can Enter into a Relationship of Respect, Compassion, and Sensitivity (Harper One, 2017). How Can I Find God? The Famous and Not-So-Famous...
Click to read more »Populationsgefährdungsanalyse
Senin, 2024-09-23 06:13:01Robert C. Lacy und Sherwin WB (2018). Applicability and limitations of sensitivity analyses for wildlife management. Journal of Applied Ecology 55, 1430–1440...
Click to read more »Posthörnchenwurm
Kamis, 2020-05-14 17:34:16Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...
Click to read more »National Training Laboratory
Selasa, 2025-02-18 00:43:43wurden durch Beobachtung und Selbsterfahrung (Selbsterfahrungs-Gruppe, Sensitivity-Gruppe) die sonst übliche Trennung von Lehre, Forschung und Lernen durchbrochen...
Click to read more »Martin F. Fromm
Kamis, 2025-10-16 15:37:46Jörg König, Peter Stopfer, Martin F. Fromm: A Metabolomic Analysis of Sensitivity and Specificity of 23 Previously Proposed Biomarkers for Renal Transporter‐Mediated...
Click to read more »SARS-CoV-2-Variante Omikron
Minggu, 2026-05-24 22:31:20does not appear to be impacted by Omicron; studies of the comparative sensitivity of Ag-RDTs are ongoing.“ SARS-CoV-2 Viral Mutations: Impact on COVID-19...
Click to read more »Michael Roden
Kamis, 2026-04-30 20:34:20Moser E, Roden M: Liver ATP synthesis is lower and relates to insulin sensitivity in patients with Type 2 Diabetes. In: Diabetes Care. Band 34, Nr. 2,...
Click to read more »Proteinkinaseinhibitor
Senin, 2025-06-30 04:26:31(freier Volltext). P. A. Jänne, N. Gray, J. Settleman: Factors underlying sensitivity of cancers to small-molecule kinase inhibitors. In: Nature Reviews Drug...
Click to read more »Steven Sherwood
Sabtu, 2023-03-04 05:25:18sensitivity traced to atmospheric convective mixing, Nature, Band 505, 2014, S. 37–42 mit S. Bony u. a.: Clouds, circulation and climate sensitivity,...
Click to read more »Tasmanian Passage
Rabu, 2025-07-02 00:42:49143–162 (2004) The influence of ocean gateways on climate. Numerical sensitivity studies on ocean circulation rearrangements. (PDF; 116 kB) Geophysical...
Click to read more »Sarojini Sahoo
Jumat, 2026-07-17 13:51:50Für diesen Blog erhielt sie bei den Laadli Media Awards for Gender Sensitivity 2010–11 die Auszeichnung für den besten englischsprachigen Blog. Bereits...
Click to read more »Liste von DOS-Kommandozeilenbefehlen
Rabu, 2026-05-06 01:53:58der 8.3-Konvention, wandelt Klein- in Großbuchstaben um (siehe Case sensitivity), löst auch den Joker * zu mehreren ? (z. B. *.ASM zu ????????.ASM) auf...
Click to read more »Olympus-E-System
Rabu, 2023-11-08 18:40:48@1@2Vorlage:Webachiv/IABot/olympus.de dpreview, Olympus E-30 review Olympus E-30 ISO Sensitivity / Noise levels Deutsche Olympus E-System-Webseite Offizielle Website...
Click to read more »Scolelepis squamata
Kamis, 2020-05-14 18:20:15Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...
Click to read more »STS-9
Sabtu, 2026-07-04 19:46:091126/science.225.4658.226. A. Cogoli, A. Tschopp und P. Fuchs-Bislin: Cell Sensitivity to Gravity. In: Science. Band 225, Nr. 4658, 13. Juli 1984, S. 228–230...
Click to read more »Minderheitenstress
Selasa, 2026-08-11 15:45:10gay men: An examination of internalized homonegativity and rejection sensitivity as potential mechanisms. In: Journal of Consulting and Clinical Psychology...
Click to read more »Johan Auwerx
Rabu, 2026-07-01 03:28:36decreased receptor activity, lower body mass index and improved insulin sensitivity, Nature Genetics, Band 20, 1998, S. 284–287 mit T. T. Lu u. a.: Molecular...
Click to read more »Treibhaus Erde
Rabu, 2026-05-06 18:08:57Rondanelli, Jens Olaf Pepke Pedersen: Deep time evidence for climate sensitivity increase with warming. In: Geophysical Research Letters. 43. Jahrgang...
Click to read more »Homunculus (Gattung)
Minggu, 2025-10-12 23:52:09Richard F. Kay und Matthew W. Colbert: Auditory Morphology and Hearing Sensitivity in Fossil New World Monkeys. The Anatomical Record 293, 2010, S. 1711–1721...
Click to read more »ISO 5800
Minggu, 2024-12-22 00:20:11ergeben. Die zugehörigen Empfindlichkeitsleitwerte Sv (engl. speed value / sensitivity) (auch als logarithmische ASA-Grad bekannt) unterstützen bei der Berechnung...
Click to read more »6-Shogaol
Minggu, 2026-01-25 02:38:08Products: Effects of Ionization Polarity and Mobile Phase Modifier on the Sensitivity. In: Journal of Food Science. Band 81, Nr. 10, Oktober 2016, PMID 27589022...
Click to read more »Kurzschnäuziges Seepferdchen
Selasa, 2025-11-25 01:38:09Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...
Click to read more »Phytophthora cactorum
Senin, 2025-12-01 01:42:26PMID 20222560. S. N. Hill, M. K. Hausbeck: Virulence and fungicide sensitivity of Phytophthora cactorum isolated from American ginseng gardens in Wisconsin...
Click to read more »Polaritätselement
Senin, 2025-06-09 03:49:38Linguistic Society. Band 11, 1975, S. 188–199. William A. Ladusaw: Polarity Sensitivity as Inherent Scope Relations. 1979. Anke von Bergen, Karl von Bergen:...
Click to read more »Leroy Hood
Senin, 2026-02-09 01:58:12Service to Society 2019 IRI Medal New Protein Sequenator with Increased Sensitivity. In: Science. Band 207, 1980, S. 523 (mit M. W. Hunkapiller) A Microchemical...
Click to read more »Cadmiumwolframat
Minggu, 2026-01-25 00:42:37Yurchenko: Further study of CdWO4 crystal scintillators as detectors for high sensitivity experiments: Scintillation properties and pulse-shape discrimination...
Click to read more »Ulrike Lohmann
Selasa, 2026-04-07 02:05:19Disentangling greenhouse warming and aerosol cooling to reveal Earth’s climate sensitivity. In: Nature Geoscience. Band 9, Nr. 4, 2016, S. 286. doi:10.1038/ngeo2670...
Click to read more »Marisa Carrasco
Jumat, 2026-08-07 09:58:13Epub 2001 Apr 17. Marisa Carrasco: Covert attention increases contrast sensitivity: psychophysical, neurophysiological and neuroimaging studies. In: Visual...
Click to read more »Robert Tannenbaum
Sabtu, 2025-06-14 05:39:26modernen Theorie der Kleingruppenprozesse, dem Sensitivitäts-Training (Sensitivity training) und T-Gruppen (T-groups) wesentliche Impulse. Tannenbaum beschrieb...
Click to read more »HCN-Kanal
Jumat, 2026-04-24 12:34:18Ludwig, F. Hofmann, M. Biel: A single histidine residue determines the pH sensitivity of the pacemaker channel HCN2. In: J Biol Chem. 276, 2001, S. 6313–6319...
Click to read more »32P-Postlabeling
Kamis, 2023-01-05 04:00:56Nachweisgrenze liegt bei 1 Addukt auf 1010 N. Ramesh C. Gupta: Enhanced Sensitivity of 32P-Postlabeling Analysis of Aromatic Carcinogen: DNA Adducts. in:...
Click to read more »Grönländischer Eisschild
Minggu, 2026-07-05 13:01:03Accelerating changes in ice mass within Greenland, and the ice sheet’s sensitivity to atmospheric forcing. In: PNAS. Band 116, Nr. 6, 22. Januar 2019, S...
Click to read more »Zeitlosengewächse
Jumat, 2026-07-03 23:08:48(Abschnitt Systematik) Juliana Chacón, Susanne S. Renner: Assessing model sensitivity in ancestral area reconstruction using Lagrange: A case study using the...
Click to read more »Fenstermücken
Senin, 2025-09-08 12:15:01Verlag, Stuttgart 1994. Norbert Israelewski: The relation of radiation sensitivity to pronuclear chromosome structure. I. Different radiation sensitivities...
Click to read more »Fampridin
Sabtu, 2026-01-24 15:58:02M. J. Monteiro, J. Z. Yeh, C. T. Bever: Inactivation gating and 4-AP sensitivity in human brain Kv1.4 potassium channel. In: Brain Res. Nr. 831, 1999...
Click to read more »Crangon allmanni
Sabtu, 2025-03-08 06:10:45Crangon allmanni. A shrimp. Marine Life Information Network: Biology and Sensitivity Key Information Sub-programme, 2009. (Online) Crangon allmani im Marine...
Click to read more »Central Great Plains
Minggu, 2024-12-08 18:43:29K. Lauenroth et al.: Regional Analysis of the Central Great Plains: Sensitivity to Climate Variability. In: BioScience, Band 41, Nummer 10, November...
Click to read more »Markus Reichstein
Senin, 2026-01-26 05:48:15Montagnani, A. D. Richardson: Global Convergence in the Temperature Sensitivity of Respiration at Ecosystem Level. In: Science. Band 329, 2010, S. 838–840...
Click to read more »Sideway Look
Senin, 2026-05-25 16:05:55steer a slightly derivative course somewhere between Aztec Camera’s sensitivity and Big Country’s grandeur, with a touch of Simple Minds.“ (Ira A. Robbins)...
Click to read more »Gozinto-Verfahren
Senin, 2024-01-08 13:50:07set graphs. In: Tomas Gal, Harvey J. Greenberg (Hrsg.): Advances in sensitivity analysis and parametric programming. (= International Series in Operations...
Click to read more »Oligomycin A
Rabu, 2026-04-22 13:46:39oxidative phosphorylation. 8. Properties of a factor conferring oligomycin sensitivity on mitochondrial adenosine triphosphatase. In: The Journal of Biological...
Click to read more »Susanne Cook-Greuter
Selasa, 2026-06-30 07:28:59Lynam, Steven Schapiro: Development Of Ego Stages And Intercultural Sensitivity Through Doctoral Study. Fielding Graduate University, USA, [2] Sharon...
Click to read more »Kalorienrestriktion
Senin, 2026-03-30 01:27:31: Effect of calorie restriction with or without exercise on insulin sensitivity, beta-cell function, fat cell size, and ectopic lipid in overweight subjects...
Click to read more »ANSI music
Rabu, 2025-12-03 22:04:17vor dem Musikteil und ←[u ←[a ←[0m danach. Der englische Begriff case sensitivity beschreibt, wie ein System mit Groß- und Kleinschreibung umgeht. DOS...
Click to read more »Gisela Trommsdorff
Kamis, 2026-01-22 21:01:37mit J. Ziehm, T. Heikamp und S. Y. Park: German and Korean mothers' sensitivity and related parenting beliefs. In: Frontiers in Psychology. Band 4, 2013...
Click to read more »Simnia patula
Minggu, 2021-07-25 20:08:39Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network: Biology and Sensitivity Key Information Reviews, Marine Biological Association of the United...
Click to read more »2020
Jumat, 2026-07-24 04:02:34Gregory J. Hakim, Christopher J. Poulsen: Glacial cooling and climate sensitivity revisited. In: Nature. 584. Jahrgang, Nr. 7822, August 2020, ISSN 1476-4687...
Click to read more »European Social Work Research Association
Rabu, 2025-05-28 17:52:281989: East-West Exchanges Between Universal Principles and Cultural Sensitivity“, Springer 2020, ISBN 978-3030458102, S. 94 ESWRA Award auf ESWRA-Webseite...
Click to read more »Förster-Resonanzenergietransfer
Sabtu, 2026-04-25 19:02:0411999692 (englisch). Mekler VM: A photochemical technique to enhance sensitivity of detection of fluorescence resonance energy transfer. In: Photochem...
Click to read more »Paläoklimatologie
Sabtu, 2026-06-27 01:37:31Rondanelli, Jens Olaf Pepke Pedersen: Deep time evidence for climate sensitivity increase with warming. In: Geophysical Research Letters. Band 43, Nr...
Click to read more »Tiergift
Senin, 2026-02-16 04:43:19D. Valentine, Lawrence M. Lichtenstein: Epidemiology of insect venom sensitivity. In: JAMA. 262, Nr. 2, 1989, S. 240–244, doi:10.1001/jama.1989.03430020082033...
Click to read more »Ozeanzirkulation
Selasa, 2026-01-06 22:49:52Remote Influences on the Heat Content of the Labrador Sea: An Adjoint Sensitivity Study. In: JGR Oceans, Band 123, Ausgabe 4, S. 2646–2667. DOI:10.1002/2018JC013774...
Click to read more »Taro Takahashi
Jumat, 2025-11-28 22:08:21geehrt. James E. Hansen und Taro Takahashi: Climate Processes and Climate Sensitivity. In: Geophysical Monograph. Band 29, Nr. 5. American Geophysical Union...
Click to read more »Silke Biermann
Sabtu, 2026-02-14 18:03:52a.: Bandwidth and Fermi surface of iron oxypnictides: Covalency and sensitivity to structural changes, Phys. Rev. B, Band 78, 2008, S. 064518 mit M....
Click to read more »Luciobarbus microcephalus
Kamis, 2024-04-04 15:41:28Clavero, F. Blanco-Garrido und J.Prenda (2009): Assessing freshwater fish sensitivity to different sources of perturbation in a Mediterranean basin. Ecology...
Click to read more »Simone Tilmes
Kamis, 2026-01-01 16:59:42begutachtete Beiträge, darunter: mit Rolf Müller, Ross Salawitch: The sensitivity of polar ozone depletion to proposed geoengineering schemes. In: Science...
Click to read more »Suyoen Kim
Sabtu, 2025-12-13 00:39:57dispatches its pyrotechnics with ease, and weaves its melodies with sensitivity and assurance. The “Concerto funèbre”, also of its time, is much darker...
Click to read more »CLOUD-Experiment
Rabu, 2026-08-12 12:47:35Zhang, 2021: The Earth’s Energy Budget, Climate Feedbacks, and Climate Sensitivity. In Climate Change 2021: The Physical Science Basis. Contribution of...
Click to read more »Sepiola rondeletii
Senin, 2025-10-20 11:37:21Sepiola rondeletii. In: Marine Life Information Network: Biology and Sensitivity Key Information Reviews. H. Tyler-Walters, K. Hiscook, 6. November 2011...
Click to read more »World3
Rabu, 2024-11-13 22:30:28Crescenzi, Giorgio Gambosi, Lucia Nasti, Aurora Rossi, Emanuele Natale: A sensitivity analysis of the Earth for all model: Getting the giant leap scenario...
Click to read more »Interdependenztheoretischer Ansatz
Minggu, 2026-08-09 16:38:20Sicherheitsinteressen, sondern insbesondere um internationale Wohlfahrt. „Sensitivity-Interdependenz“ (Sensibilität) besagt, dass Staaten zunehmend empfindlicher...
Click to read more »Karl Otto Götz
Selasa, 2026-05-12 02:41:54auch zu einem bis heute verwendeten visuellen Test (Visual-Aesthetic-Sensitivity-Test, kurz VAST) führten, veröffentlichten Götz und Rissa 1972 in ihrem...
Click to read more »2,4-Dinitroanisol
Sabtu, 2026-01-24 18:51:35Characterisation of 2,4-Dinitroanisole: An Ingredient for use in Low Sensitivity Melt Cast Formulations, 2006; PDF Datenblatt 2,4-Dinitroanisol bei Sigma-Aldrich...
Click to read more »Brutfleck
Minggu, 2026-07-19 08:50:061990, S. 168. Robert A. Hinde, R. Q. Bell, E. Steel: Changes in the sensitivity in the canary brood patch during the natural breeding season. In: Animal...
Click to read more »Chemosensitivitätstest
Jumat, 2025-05-16 01:53:54B. G. Durie, D. S. Alberts, T. E. Moon: Quantitation of differential sensitivity of human-tumor stem cells to anticancer drugs. In: The New England Journal...
Click to read more »Störung der Blut-Hirn-Schranke
Minggu, 2025-05-11 17:57:20monocytes to cross the blood-brain barrier into the brain and the in vivo sensitivity of the blood-brain barrier to disruption by lipopolysaccharide. In: J...
Click to read more »Dieter T. Roth
Sabtu, 2022-07-02 13:22:572014, S. 371–96. Missionary Ethics in Q 10:2-12. In Kobus Kok et al.: Sensitivity to Outsiders: Exploring the Dynamic Relationship between Mission and...
Click to read more »Bernd Meyer (Ökonom)
Kamis, 2025-06-19 23:06:42Zika: Economic Policy Simulations with Global Interdependencies: A Sensitivity Analysis for Germany. In: Economic Systems Research. 19(1), 2007, pp...
Click to read more »Baffinstrom
Rabu, 2026-04-15 13:15:04(2017): Evolution of Baffin Bay water masses and transports in a numerical sensitivity experiment under enhanced Greenland melt. In: Atmosphere–Ocean. Band 55...
Click to read more »Eric Van Stryland
Kamis, 2025-11-06 00:13:31Zeitschrift). M. Sheik-bahae, A. A. Said, E. W. Van Stryland: High-sensitivity, single-beam n2 measurements. In: Optics Letters. Band 14, Nr. 17, 1...
Click to read more »Manfred M. Fichter
Rabu, 2026-05-06 12:57:02Questionnaire (Munich ED-Quest) DSM-5/ICD-10: Validity, Reliability, Sensitivity to Change, and Norms. In: European Eating Disorder Review. Band 23, Nr...
Click to read more »Angriff auf Zikim 2023
Rabu, 2025-12-17 06:14:03(englisch). Master Sgt. Ido Kaslasi, 23: A perfect mix of ‘roughness, sensitivity’. timesofisrael.com, abgerufen am 7. März 2025 (englisch). Army says...
Click to read more »Trier Social Stress Test
Jumat, 2025-10-17 23:25:09D. H. Hellhammer: HPA axis reactivity and lymphocyte glucocorticoid sensitivity in fibromyalgia syndrome and chronic pelvic pain. In: Psychosom Med,...
Click to read more »Quartärforschung
Selasa, 2026-06-09 15:21:26Tigchelaar, Oliver Elison Timm, Andrey Ganopolski: Nonlinear climate sensitivity and its implications for future greenhouse warming. In: Science Advances...
Click to read more »Sekundäre innertropische Konvergenz
Minggu, 2022-08-28 19:38:31ISBN 3-14-100600-8, Karten 1 und 2, S. 128. Nathalie de Noblet et al.: Sensitivity of simulated Asian and African summer monsoons to orbitally induced variations...
Click to read more »Pine-Island-Gletscher
Senin, 2026-08-03 03:04:40J. Steig, Qinghua Ding, E. Povl Abrahamsen, Michael Schröder: Strong Sensitivity of Pine Island Ice-Shelf Melting to Climatic Variability. In: Science...
Click to read more »Der junge Häuptling Winnetou
Senin, 2026-05-25 03:46:19Sortiment. Dabei ziehen sie auch externe Fachberater zu Rate oder setzen „Sensitivity Reader“ ein, die unsere Titel kritisch auf den richtigen Umgang mit sensiblen...
Click to read more »Zirkone des Hadaikums
Jumat, 2025-12-05 01:11:10Band 23, 2013, S. 1484–1490. T. Mark Harrison und Axel K. Schmitt: High sensitivity mapping of Ti distributions in Hadean zircons. In: Earth and Planetary...
Click to read more »Martin Pall
Sabtu, 2024-10-19 23:38:15illnesses" : disease paradigm for chronic fatigue syndrome, multiple chemical sensitivity, fibromyalgia, post-traumatic stress disorder, Gulf War syndrome, and...
Click to read more »UDP-Glucose-4-Epimerase
Kamis, 2026-05-21 02:14:56KL, Malmstrom K, Krieger M, Fridovich-Keil JL: Mediators of galactose sensitivity in UDP-galactose 4'-epimerase-impaired mammalian cells. In: J. Biol....
Click to read more »Magnetic Particle Imaging
Kamis, 2026-02-12 05:38:31Weizenecker, J. Borgert, B. Gleich: A simulation study on the resolution and sensitivity of magnetic particle imaging. In: Physics in Medicine and Biology. Band 52...
Click to read more »Piotr Potworowski
Jumat, 2024-12-20 20:06:39of our own day, but reveals an exquisite taste and the most delicate sensitivity qualities which are, perhaps, rather less characteristic of the present...
Click to read more »Ruth Ella Moore
Selasa, 2024-05-07 18:00:3918 (1): Article 2., 1938. mit M. S. Briscoe, Dewey E. Puckett: The Sensitivity to Antibiotics of Microorganisms Isolated from the Gut of "Blaberus caniifer"...
Click to read more »Adam Davison Smith
Sabtu, 2026-07-04 01:25:50Dwork, Frank McSherry, Kobbi Nissim, Adam Smith: Calibrating Noise to Sensitivity in Private Data Analysis. In: Shai Halevi, Tal Rabin (Hrsg.): Theory...
Click to read more »Luria-Delbrück-Experiment
Jumat, 2020-11-20 13:50:12Newcombe-Experiment Luria, S. E., Delbrück, M.: Mutations of bacteria from virus sensitivity to virus resistance. In: Genetics. Band 28, Nummer 6, November 1943,...
Click to read more »Liste von Seen in Tansania
Selasa, 2026-05-12 18:09:50Jerker Jarsjö: Water Balance and Level Change of Lake Babati, Tanzania: Sensitivity to Hydroclimatic Forcings. (PDF) 5. Dezember 2016, S. 3, abgerufen am...
Click to read more »Anschlussmotivation
Selasa, 2024-04-16 09:52:12basieren. Er nennt sie „affiliative tendency“ (Anschlusstendenz; R1) und „sensitivity to rejection“ (Sensibilität für Zurückweisung; R2). Die Fragebögen fordern...
Click to read more »Schmerzempfinden von Tieren
Selasa, 2026-06-16 19:05:012003, S. 49–51. OLG Düsseldorf, NStZ 1994, 43. Joan Dunayer: Fish: Sensitivity Beyond the Captor’s Grasp. In: The Animals’ Agenda. (Juli/August), 1991...
Click to read more »Chip Scale Package
Rabu, 2025-09-17 21:35:35com/documents/public/application-notes/an0878_methods_of_reducing_light_sensitivity_in_csp_packages.pdf https://ez.analog.com/power/w/documents/4803/photosensitiv...
Click to read more »Einstein@Home
Senin, 2025-11-10 15:42:15et al.: The Einstein@home gamma-ray pulsar survey I - search methods, sensitivity and discovery of new young gamma-ray pulsars, 2016, arxiv:1611.01015...
Click to read more »SARS-CoV-2-Variante Delta
Rabu, 2026-05-27 13:21:17s. a. doi:10.1101/2021.08.12.456173 Delphine Planas et al.: Reduced sensitivity of SARS-CoV-2 variant Delta to antibody neutralization. In: Nature. Vol...
Click to read more »Martin Klingenspor
Selasa, 2026-03-17 21:00:55(2005). M Klingenspor, H Niggemann, G Heldmaier: Modulation of leptin sensitivity by short photoperiod acclimation in the Djungarian hamster, Phodopus...
Click to read more »Frostmusterboden
Senin, 2025-11-03 23:17:17B. T. Werner: Nonlinear dynamics of ice-wedge networks and resulting sensitivity. In: Nature. Band 417, S. 929–932, 2002 (online (Memento vom 18. Oktober...
Click to read more »