SBP-Tag
Das SBP-Tag (von englisch Streptavidin binding peptide tag) ist ein Protein-Tag, das in der Biochemie zur Proteinreinigung und zum -nachweis verwendet wird.
Eigenschaften
Das SBP-Tag wird unter anderem zur Affinitätschromatographie und zu Pulldown-Assays verwendet. Es hat die Aminosäuresequenz MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. Das SBP-Tag wurde per mRNA-Display erzeugt.[1] Die Selektion erfolgte im Hochdurchsatz unter Inkubation von einer Peptid-Bibliothek mit Streptavidin-Agarose und einer Elution mit Biotin. Das SBP-Tag bindet an Streptavidin mit einer Dissoziationskonstante von 2,5 nM.[1][2] Die Elution erfolgt durch Zugabe von Biotin unter nativen Bedingungen.[1][2]
Anwendungen
Das SBP-Tag wird unter anderem als einer der beiden Trennschritte im Zuge einer Tandem Affinity Purification verwendet.[3][4]
Einzelnachweise
- ↑ a b c David S. Wilson, Anthony D. Keefe, Jack W. Szostak: The use of mRNA display to select high-affinity protein-binding peptides. In: Proceedings of the National Academy of Sciences. 98. Jahrgang, Nr. 7, 2001, S. 3750–5, doi:10.1073/pnas.061028198, PMID 11274392, PMC 31124 (freier Volltext) – (englisch).
- ↑ a b Anthony D. Keefe, David S. Wilson, Burckhard Seelig, Jack W. Szostak: One-Step Purification of Recombinant Proteins Using a Nanomolar-Affinity Streptavidin-Binding Peptide, the SBP-Tag. In: Protein Expression and Purification. 23. Jahrgang, Nr. 3, 2001, S. 440–6, doi:10.1006/prep.2001.1515, PMID 11722181 (englisch).
- ↑ Jelle Van Leene, Dominique Eeckhout, Geert Persiau, Eveline Van De Slijke, Jan Geerinck, Gert Van Isterdael, Erwin Witters, Geert De Jaeger: Plant Transcription Factors. Hrsg.: Ling Yuan, Sharyn E. Perry (= Methods in Molecular Biology. Band 754, Nr. 4). 2011, ISBN 978-1-61779-153-6, Isolation of Transcription Factor Complexes from Arabidopsis Cell Suspension Cultures by Tandem Affinity Purification, S. 195–218, doi:10.1007/978-1-61779-154-3_11, PMID 21720954 (englisch).
- ↑ Azlinda Anwar, K. M. Leong, Mary L. Ng, Justin J. H. Chu, Mariano A. Garcia-Blanco: The Polypyrimidine Tract-binding Protein Is Required for Efficient Dengue Virus Propagation and Associates with the Viral Replication Machinery. In: Journal of Biological Chemistry. 284. Jahrgang, Nr. 25, 2009, S. 17021–9, doi:10.1074/jbc.M109.006239, PMID 19380576, PMC 2719340 (freier Volltext) – (englisch).
Content Disclaimer
Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.
- The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
- There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
- It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
- Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
- Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.