LL-37

LL-37
LL-37
3D-Strukturmodell von LL-37
Andere Namen

[LL-37, 37 aa]

Vorhandene Strukturdaten: 2K6O

Eigenschaften des menschlichen Proteins
Masse/Länge Primärstruktur 37 Aminosäuren
Präkursor (170 Aminosäuren)
Bezeichner
Gen-Name
Externe IDs
Transporter-Klassifikation
TCDB
Bezeichnung Cathelicidin-Familie (Porine)
Vorkommen
Übergeordnetes Taxon Wirbeltiere[1]
Orthologe
Mensch Hausmaus
Entrez 820 12796
Ensembl ENSG00000164047 ENSMUSG00000038357
UniProt P49913 P51437
Refseq (mRNA) NM_004345 NM_009921
Refseq (Protein) NP_004336 NP_034051
Genlocus Chr 3: 48.22 – 48.23 Mb Chr 9: 109.85 – 109.85 Mb
PubMed-Suche 820 12796

LL-37 ist ein menschliches antimikrobielles Peptid aus der Gruppe der Cathelicidine. Es wird hauptsächlich in Immunzellen produziert und ist Teil der angeborenen Immunantwort sowie der Apoptose körpereigener Zellen. Es handelt sich um ein Transportprotein, dessen Einbau einerseits in die Zellwand grampositiver Bakterien sowie andererseits in die Zellmembran zu einem Verlust von Ionen und kleinen Molekülen führt. Es wird durch das CAMP-Gen codiert.[2]

Die Produktion von LL-37 wird insbesondere durch Stimulation des TLR-9, aber auch TLR-2 und TLR-4 und indirekt durch Vitamin D angeregt.[3][4]

Biosynthese

Die Biosynthese von LL-37 ist ein mehrstufiger Prozess. Es wird durch das CAMP-Gen auf Chromosom 3 codiert. Dieses Gen besteht, wie auch die Cathelicidin-Gene anderer Säugetiere, aus vier Exons. Die antimikrobielle Aktivität wird durch das hypervariable Exon 4 codiert, während die Exons 1 bis 3 eine Signalpeptidsequenz und die darauf folgende Cathelin-Domäne codieren.[5]

Primär wird ein Präpropeptide synthetisiert und in den Granula neutrophiler Granulozyten oder anderer Zellen gespeichert. Nach Freisetzung dieser biologisch inaktiven Propeptide werden sie enzymatisch durch Elastase oder andere Proteinasen in ein Cathelin und ein C-terminales antimikrobielles Peptid, das aus 37 Aminosäuren bestehende LL-37, gespalten.

Im Einbuchstabencode lautet die Peptidsequenz von LL-37 [LL-37, 37 aa][6]

Literatur

Zanetti M: The role of cathelicidins in the innate host defenses of mammals. In: Curr Issues Mol Biol. 7. Jahrgang, Nr. 2, Juli 2005, S. 179–96, PMID 16053249 (englisch, horizonpress.com [PDF]).

Einzelnachweise

  1. Suchergebnis Cathelicidine nach Taxonomie
  2. UniProt P49913
  3. Rivas-Santiago B, Hernandez-Pando R, Carranza C, et al.: Expression of cathelicidin LL-37 during Mycobacterium tuberculosis infection in human alveolar macrophages, monocytes, neutrophils, and epithelial cells. In: Infection and Immunity. 76. Jahrgang, Nr. 3, März 2008, S. 935–41, doi:10.1128/IAI.01218-07, PMID 18160480, PMC 2258801 (freier Volltext) – (englisch).
  4. Yuk JM, Shin DM, Lee HM, et al.: Vitamin D3 induces autophagy in human monocytes/macrophages via cathelicidin. In: Cell Host Microbe. 6. Jahrgang, Nr. 3, September 2009, S. 231–43, doi:10.1016/j.chom.2009.08.004, PMID 19748465 (englisch).
  5. Tomasinsig L, Zanetti M: The cathelicidins – structure, function and evolution. In: Curr. Protein Pept. Sci. 6. Jahrgang, Nr. 1, Februar 2005, S. 23–34, PMID 15638766 (englisch).
  6. A. Pini, C. Falciani u. a.: A novel tetrabranched antimicrobial peptide that neutralizes bacterial lipopolysaccharide and prevents septic shock in vivo. In: FASEB journal. Band 24, Nummer 4, April 2010, S. 1015–1022, ISSN 1530-6860. doi:10.1096/fj.09-145474. PMID 19917670.

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.